Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Immunology Innate Immunity Macrophage / Inflamm.

Anti-GPNMB antibody [7C10E5] (ab175427)

Price and availability

268 032 ₸

Availability

Order now and get it on Wednesday March 03, 2021

Anti-GPNMB antibody [7C10E5] (ab175427)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [7C10E5] to GPNMB
  • Suitable for: WB, IHC-P
  • Reacts with: Human, Recombinant fragment
  • Isotype: IgG1

You may also be interested in

Synthetic Human CX3CL1 protein (Biotin) (ab176091)
Recombinant Human CHIT1 protein (ab151883)
Product image
Anti-Leukotriene B4 Receptor 2 antibody (ab84600)
Product image
Anti-AMCase antibody [EPR19985] - BSA and Azide free (ab251464)

Overview

  • Product name

    Anti-GPNMB antibody [7C10E5]
    See all GPNMB primary antibodies
  • Description

    Mouse monoclonal [7C10E5] to GPNMB
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Recombinant fragment
  • Immunogen

    Recombinant fragment corresponding to Human GPNMB aa 31-260.
    Sequence:

    NERPSAYMREHNQLNGWSSDENDWNEKLYPVWKRGDMRWKNSWKGGRVQA VLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNCRNEAGLSADP YVYNWTAWSEDSDGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTL GQYFQKLGRCSVRVSVNTANVTLGPQLMEVTVYRRHGRAYVPIAQVKDVY VVTDQIPVFVTMFQKNDRNSSDETFLKDLP


    Database link: Q14956
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • GPNMB recombinant protein; GPNMB-hIgGFc transfected HEK293 cell lysate; PANC1 and PC-3 cell lysate; Breast cancer tissues; Esophagus cancer tissues.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    7C10E5
  • Isotype

    IgG1
  • Research areas

    • Immunology
    • Innate Immunity
    • Macrophage / Inflamm.
    • Cancer
    • Tumor immunology
    • Tumor-associated antigens

Images

  • Western blot - Anti-GPNMB antibody [7C10E5] (ab175427)
    Western blot - Anti-GPNMB antibody [7C10E5] (ab175427)
    All lanes : Anti-GPNMB antibody [7C10E5] (ab175427) at 1/500 dilution

    Lane 1 : HEK293 cell lysate
    Lane 2 : GPNMB (AA: 31-260)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 64 kDa

  • Western blot - Anti-GPNMB antibody [7C10E5] (ab175427)
    Western blot - Anti-GPNMB antibody [7C10E5] (ab175427)
    Anti-GPNMB antibody [7C10E5] (ab175427) at 1/500 dilution + GPNMB recombinant protein.

    Predicted band size: 64 kDa

  • Western blot - Anti-GPNMB antibody [7C10E5] (ab175427)
    Western blot - Anti-GPNMB antibody [7C10E5] (ab175427)
    All lanes : Anti-GPNMB antibody [7C10E5] (ab175427) at 1/500 dilution

    Lane 1 : PANC1 cell lysate.
    Lane 2 : PC-3 cell lysate

    Predicted band size: 64 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GPNMB antibody [7C10E5] (ab175427)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GPNMB antibody [7C10E5] (ab175427)

    Immunohistochemical analysis of paraffin-embedded esophagus cancer tissues labeling GPNMB wiith ab175427 at 1/200 diution, with DAB staining.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GPNMB antibody [7C10E5] (ab175427)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-GPNMB antibody [7C10E5] (ab175427)

    Immunohistochemical analysis of paraffin-embedded breast cancer tissues labeling GPNMB wiith ab175427 at 1/200 diution, with DAB staining.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-GPNMB antibody [7C10E5] (ab175427)

  •  
  • Product image

    Anti-GPNMB antibody [SP299] (ab227695)

    Applications: Flow Cyt, IHC-P, WB

  •  
  • Product image

    Anti-GPNMB antibody [EPR22011-11] (ab222109)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-GPNMB antibody [EPR22011-47] (ab235873)

    Applications: Flow Cyt, ICC/IF, WB

  •  
  • Product image

    Anti-GPNMB antibody [EPR22011-11] - BSA and Azide free (ab236209)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-GPNMB antibody [EPR18226-147] (ab188222)

    Applications: Flow Cyt, ICC/IF, IP, WB

  •  
  • Product image

    Anti-GPNMB antibody [EPR18226-147] - BSA and Azide free (ab234529)

    Applications: Flow Cyt, ICC/IF, IP, WB

  •  
  • Product image

    Anti-GPNMB antibody [EPR22011-47] - BSA and Azide free (ab236211)

    Applications: Flow Cyt, ICC/IF, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-ARID1A antibody [EPR13501] (ab182560)

  •  
  • Product image

    Anti-RHEB antibody [EPR2971] (ab92313)

  •  
  • Product image

    Anti-S100A9 antibody [EPR22332-75] (ab242945)

  •  
  • Product image

    Anti-Glutamine Synthetase antibody (ab64613)

  •  
  • Product image

    Anti-IGFBP5 antibody [EPR18013-137] (ab254324)

  •  
  • Product image

    Anti-PKC theta/PRKCQ antibody [EPR1488Y] (ab52494)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.