Anti-FAAH1 antibody (ab54615)
Key features and details
- Mouse monoclonal to FAAH1
- Suitable for: WB, IP
- Reacts with: Mouse, Rat, Human
- Isotype: IgG2a
Overview
-
Product name
Anti-FAAH1 antibody
See all FAAH1 primary antibodies -
Description
Mouse monoclonal to FAAH1 -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species IP MouseWB MouseRatHuman -
Immunogen
Recombinant fragment corresponding to Human FAAH1 aa 480-579.
Sequence:DLNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGD IWDKMLQKGMKKSVGLPVAVQCVALPWQEELCLRFMREVERLMTPEKQSS
-
General notes
This product was changed from ascites to tissue culture supernatant on 17/04/2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.40
Constituents: 8% Sodium chloride, 0.6% Dibasic monohydrogen sodium phosphate, 0.2% Monobasic dihydrogen potassium phosphate, 0.2% Potassium chloride, 91% Water -
Concentration information loading... -
Purity
Tissue culture supernatant -
Clonality
Monoclonal -
Isotype
IgG2a -
Light chain type
kappa -
Research areas
Images
-
FAAH1 was immunoprecipitated using 0.5mg Mouse Liver whole tissue extract, 5µg of Mouse monoclonal to FAAH1 and 50µl of protein G magnetic beads (+). No antibody was added to the control (-).
The antibody was incubated under agitation with Protein G beads for 10min, Mouse Liver whole tissue extract lysate diluted in RIPA buffer was added to each sample and incubated for a further 10min under agitation.
Proteins were eluted by addition of 40µl SDS loading buffer and incubated for 10min at 70oC; 10µl of each sample was separated on a SDS PAGE gel, transferred to a nitrocellulose membrane, blocked with 5% BSA and probed with ab54615.
Secondary: Goat polyclonal to mouse IgG light chain specific (HRP) at 1/5000 dilution.
Band: 63kDa: FAAH1.This image was generated using the ascites version of the product.
-
FAAH antibody (ab54615) at 1ug/lane + A-431 cell lysate at 25ug/lane.
This image was generated using the ascites version of the product.
-
Anti-FAAH1 antibody (ab54615) + Rat Brain
Predicted band size: 63 kDaThis image was generated using the ascites version of the product.
-
Anti-FAAH1 antibody (ab54615) + PC-12
Predicted band size: 63 kDaThis image was generated using the ascites version of the product.
-
Anti-FAAH1 antibody (ab54615) + NIH/3T3
Predicted band size: 63 kDaThis image was generated using the ascites version of the product.

