Anti-EDIL3/DEL1 antibody (ab88667)
Key features and details
- Mouse monoclonal to EDIL3/DEL1
- Suitable for: WB
- Reacts with: Human, Recombinant fragment
- Isotype: IgG2a
Overview
-
Product name
Anti-EDIL3/DEL1 antibody
See all EDIL3/DEL1 primary antibodies -
Description
Mouse monoclonal to EDIL3/DEL1 -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human, Recombinant fragment
Predicted to work with: Mouse, Xenopus laevis, Zebrafish, Orangutan -
Immunogen
Recombinant fragment corresponding to Human EDIL3/DEL1 aa 101-199.
Sequence:IGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFM GRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKK
Database link: NP_005702 -
Positive control
- Partial tagged recombinant Human EDIL3/DEL1 protein (the immunogen). Human pancreas tissue lysate.
-
General notes
This product was changed from ascites to tissue culture supernatant on 30th April 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
Previously labelled as EDIL3.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.4
Constituent: 2.68% PBS -
Concentration information loading...
-
Purity
Tissue culture supernatant -
Purification notes
Purified from TCS. -
Clonality
Monoclonal -
Isotype
IgG2a -
Light chain type
kappa -
Research areas
Images
-
Anti-EDIL3/DEL1 antibody (ab88667) at 5 µg/ml + Partial tagged recombinant human EDIL3/DEL1 protein (the immunogen) at 0.2 µg
Predicted band size: 54 kDa
Observed band size: 37 kDa why is the actual band size different from the predicted?Western blot against tagged recombinant protein immunogen. Predicted band size of immunogen is 37 kDa.
This image was generated using the ascites version of the product.
-
Anti-EDIL3/DEL1 antibody (ab88667) at 5 µg/ml + human pancreas tissue lysate at 50 µg
Predicted band size: 54 kDa
Observed band size: 54 kDaThis image was generated using the ascites version of the product.