Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Cytoskeleton / ECM Cell Adhesion Cell Adhesion Molecules Endothelial

Anti-EDIL3/DEL1 antibody (ab88667)

Anti-EDIL3/DEL1 antibody (ab88667)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal to EDIL3/DEL1
  • Suitable for: WB
  • Reacts with: Human, Recombinant fragment
  • Isotype: IgG2a

You may also be interested in

Recombinant Human EDIL3/DEL1 protein (ab152047)
Product image
Anti-LIN7B antibody (ab101339)
Product image
Anti-CEECAM1 antibody [EPR13744] - BSA and Azide free (ab250547)
Product image
Anti-Ajuba antibody (ab64451)

Overview

  • Product name

    Anti-EDIL3/DEL1 antibody
    See all EDIL3/DEL1 primary antibodies
  • Description

    Mouse monoclonal to EDIL3/DEL1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human, Recombinant fragment
    Predicted to work with: Mouse, Xenopus laevis, Zebrafish, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human EDIL3/DEL1 aa 101-199.
    Sequence:

    IGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFM GRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKK


    Database link: NP_005702
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Partial tagged recombinant Human EDIL3/DEL1 protein (the immunogen). Human pancreas tissue lysate.
  • General notes

    This product was changed from ascites to tissue culture supernatant on 30th April 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

    Previously labelled as EDIL3. 

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    pH: 7.4
    Constituent: 2.68% PBS
  • Concentration information loading...
  • Purity

    Tissue culture supernatant
  • Purification notes

    Purified from TCS.
  • Clonality

    Monoclonal
  • Isotype

    IgG2a
  • Light chain type

    kappa
  • Research areas

    • Signal Transduction
    • Cytoskeleton / ECM
    • Cell Adhesion
    • Cell Adhesion Molecules
    • Endothelial
    • Signal Transduction
    • Cytoskeleton / ECM
    • Cell Adhesion
    • Integrins
    • Alpha
    • Signal Transduction
    • Cytoskeleton / ECM
    • Cell Adhesion
    • Integrins
    • Beta
    • Cardiovascular
    • Angiogenesis
    • Angiogenic Factors

Images

  • Western blot - Anti-EDIL3/DEL1 antibody (ab88667)
    Western blot - Anti-EDIL3/DEL1 antibody (ab88667)
    Anti-EDIL3/DEL1 antibody (ab88667) at 5 µg/ml + Partial tagged recombinant human EDIL3/DEL1 protein (the immunogen) at 0.2 µg

    Predicted band size: 54 kDa
    Observed band size: 37 kDa
    why is the actual band size different from the predicted?



    Western blot against tagged recombinant protein immunogen. Predicted band size of immunogen is 37 kDa.

    This image was generated using the ascites version of the product.

  • Western blot - Anti-EDIL3/DEL1 antibody (ab88667)
    Western blot - Anti-EDIL3/DEL1 antibody (ab88667)
    Anti-EDIL3/DEL1 antibody (ab88667) at 5 µg/ml + human pancreas tissue lysate at 50 µg

    Predicted band size: 54 kDa
    Observed band size: 54 kDa



    This image was generated using the ascites version of the product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-EDIL3/DEL1 antibody (ab88667)

  •  
  • Product image

    Anti-EDIL3/DEL1 antibody (ab151308)

    Applications: IHC-P, WB

  •  
  • Product image

    Alexa Fluor® 647 Anti-EDIL3/DEL1 antibody [EPR12451] (ab203166)

    Applications: Flow Cyt, ICC/IF

  •  
  • Product image

    Anti-EDIL3/DEL1 antibody (ab67573)

    Applications: WB

  •  
  • Product image

    Alexa Fluor® 488 Anti-EDIL3/DEL1 antibody [EPR12451] (ab203164)

    Applications: Flow Cyt, ICC/IF

  •  
  • Product image

    Anti-EDIL3/DEL1 antibody (ab198003)

    Applications: IHC-P

  •  
  • Product image

    Anti-EDIL3/DEL1 antibody [EPR12451] (ab190692)

    Applications: Flow Cyt, ICC/IF, IP, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-Nucleophosmin antibody (ab15440)

  •  
  • Product image

    Anti-ACADVL/VLCAD antibody (ab155138)

  •  
  • Product image

    Anti-IFI44 antibody (ab236657)

  •  
  • Product image

    Anti-MZT2A antibody (ab247114)

  •  
  • Anti-MRP8 + MRP14 antibody [5.5] (ab20222)

  •  
  • Product image

    Anti-TXNL1 antibody (ab238163)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.