Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Cytoskeleton / ECM Extracellular Matrix ECM Proteins Collagen

Anti-Decorin antibody [5E8E7] (ab181456)

Price and availability

291 484 ₸

Availability

Order now and get it on Wednesday February 24, 2021

Anti-Decorin antibody [5E8E7] (ab181456)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [5E8E7] to Decorin
  • Suitable for: Flow Cyt, WB
  • Reacts with: Human
  • Isotype: IgG1

You may also be interested in

Product image
Anti-Collagen II antibody (ab34712)
Product image
Anti-Collagen XVII antibody [EPR18614] - BSA and Azide free (ab271950)
Product image
Anti-Collagen III antibody - C-terminal (ab216430)
Product image
Human Pro-Collagen I alpha 1 Matched Antibody Pair Kit (ab216064)

Overview

  • Product name

    Anti-Decorin antibody [5E8E7]
    See all Decorin primary antibodies
  • Description

    Mouse monoclonal [5E8E7] to Decorin
  • Host species

    Mouse
  • Tested applications

    Suitable for: Flow Cyt, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Sheep, Rabbit, Horse, Cow, Dog, Pig, Chimpanzee
  • Immunogen

    Recombinant fragment corresponding to Human Decorin aa 263-324. (Expressed in E.coli).
    Sequence:

    GSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDF CPPGHNTKKASY


    Database link: P07585
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • Human Decorin recombinant protein; Decorin (aa: 263-324)-hIgGFc transfected HEK293 cell lysate; HEK293 cells.
  • General notes

    This product was changed from ascites to supernatant. Lot no’s high than GR150953-11 are from Tissue Culture Supernatant

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: 99% PBS

    Contains 0.5% protein stabilizer (Amino acid =85%, pH(1% water solution) =7.0~7.5, Water =2%, As(mg/kg) =0.5, Pb(mg/kg) =0.1).
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    5E8E7
  • Isotype

    IgG1
  • Research areas

    • Signal Transduction
    • Cytoskeleton / ECM
    • Extracellular Matrix
    • ECM Proteins
    • Collagen
    • Signal Transduction
    • Cytoskeleton / ECM
    • Extracellular Matrix
    • Structures
    • Bone
    • Stem Cells
    • Mesenchymal Stem Cells
    • Osteogenesis

Images

  • Western blot - Anti-Decorin antibody [5E8E7] (ab181456)
    Western blot - Anti-Decorin antibody [5E8E7] (ab181456)
    Anti-Decorin antibody [5E8E7] (ab181456) at 1/500 dilution + Human Decorin recombinant protein

    Predicted band size: 40 kDa



    Expected MWt is 32.5 kDa.

  • Western blot - Anti-Decorin antibody [5E8E7] (ab181456)
    Western blot - Anti-Decorin antibody [5E8E7] (ab181456)
    All lanes : Anti-Decorin antibody [5E8E7] (ab181456) at 1/500 dilution

    Lane 1 : HEK293 cell lysate
    Lane 2 : Decorin (aa: 263-324)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 40 kDa

  • Flow Cytometry - Anti-Decorin antibody [5E8E7] (ab181456)
    Flow Cytometry - Anti-Decorin antibody [5E8E7] (ab181456)

    Flow cytometric analysis of HEK293 cells labeling Decorin with ab181456 at 1/200 dilution (green), compared to a negative control (red).

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-Decorin antibody [5E8E7] (ab181456)

  •  
  • Product image

    Anti-Decorin antibody (ab151988)

    Applications: ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-Decorin antibody (ab189364)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-Decorin antibody (ab175404)

    Applications: ICC/IF, WB

  •  
  • Product image

    Anti-Decorin antibody - N-terminal (ab189071)

    Applications: IHC-P

  •  
  • Product image

    Anti-Decorin antibody (ab137508)

    Applications: ICC/IF, WB

  •  
  • Product image

    Anti-Decorin antibody [DCN/3523] (ab268048)

    Applications: IHC-P, Protein Array

  •  
  • Product image

    Anti-Decorin antibody [DCN/3523] - BSA and Azide free (ab268168)

    Applications: IHC-P, Protein Array

Clear all

Recently viewed products

  •  
  • Product image

    Anti-FOXB2 antibody [EPR11476] (ab170897)

  •  
  • Product image

    Anti-HADHB antibody [5C3AB7] (ab110301)

  •  
  • Product image

    Anti-FOXP2 antibody [CL5312] (ab243038)

  •  
  • Product image

    Anti-LC3C antibody [EPR8077] (ab150367)

  •  
  • Product image

    Anti-Collagen III antibody (ab7778)

  •  
  • Product image

    Anti-Claudin 2 antibody (ab53032)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.