Recombinant Mouse PD-L2 protein (ab214612)
Key features and details
- Expression system: CHO cells
- Purity: > 98% SDS-PAGE
- Endotoxin level:
- Suitable for: SDS-PAGE
-
Product name
Recombinant Mouse PD-L2 protein
See all PD-L2 proteins and peptides -
Purity
> 98 % SDS-PAGE. -
Endotoxin level
Expression system
CHO cellsAccession
Protein length
Protein fragmentAnimal free
NoNature
Recombinant-
Species
Mouse -
Sequence
LFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQ SERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKV KASYMRIDTRILEVPGTGEVQLTCQARGYPLAEVSWQNVSVPANTSHIRT PEGLYQVTSVLRLKPQPSRNFSCMFWNAHMKELTSAIIDPLSRMEPKVPR -
Amino acids
20 to 219 -
Additional sequence information
The extracellular domain of mouse PD-L2 (aa 20-219) is fused to the N-terminus of the Fc region of mouse IgG2a.
Specifications
Our Abpromise guarantee covers the use of ab214612 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. Stable for 12 months at -20°C.
Constituent: 99% PBS
Lyophilized from 0.2 µm filtered solution. -
ReconstitutionReconstitute at 100 µg/mL in sterile PBS. Working aliquots are stable for up to 3 months when stored at -20°C.
General Info
-
Alternative names
- B7 dendritic cell molecule
- B7-DC
- B7DC
see all -
Function
Involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production. -
Tissue specificity
Highly expressed in heart, placenta, pancreas, lung and liver and weakly expressed in spleen, lymph nodes and thymus. -
Sequence similarities
Belongs to the immunoglobulin superfamily. BTN/MOG family.
Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Cellular localization
Secreted; Cell membrane and Endomembrane system. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab214612 has not yet been referenced specifically in any publications.
Preparation and Storage
- B7 dendritic cell molecule
- B7-DC
- B7DC