Recombinant mouse MCP3 protein (ab9912)
Key features and details
- Expression system: Escherichia coli
- Purity: >= 98% SDS-PAGE
- Endotoxin level:
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE
-
Product name
Recombinant mouse MCP3 protein
See all MCP3 proteins and peptides -
Biological activity
Determined by its ability to chemoattract BaF3 cells expressing human CCR2 receptor using a
concentration range of 300-500 ng/mL. -
Purity
>= 98 % SDS-PAGE.
= 98% by SDS-PAGE gel and HPLC analyses.s. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Mouse -
Sequence
QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVC AEAHQKWVEEAIAYLDMKTPTPKP -
Predicted molecular weight
11 kDa -
Amino acids
24 to 97
Associated products
Specifications
Our Abpromise guarantee covers the use of ab9912 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Sterile filtered through a 0.2 micron filter. Lyophilized with no additives.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionFor lot specific reconstitution information please contact our Scientific Support Team.
General Info
-
Alternative names
- C-C motif chemokine 7
- Ccl7
- CCL7_HUMAN
see all -
Function
Chemotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity. Also induces the release of gelatinase B. This protein can bind heparin. Binds to CCR1, CCR2 and CCR3. -
Sequence similarities
Belongs to the intercrine beta (chemokine CC) family. -
Post-translational
modificationsO-glycosylated. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab9912 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Alternative names
- C-C motif chemokine 7
- Ccl7
- CCL7_HUMAN
see all -
Function
Chemotactic factor that attracts monocytes and eosinophils, but not neutrophils. Augments monocyte anti-tumor activity. Also induces the release of gelatinase B. This protein can bind heparin. Binds to CCR1, CCR2 and CCR3. -
Sequence similarities
Belongs to the intercrine beta (chemokine CC) family. -
Post-translational
modificationsO-glycosylated. -
Cellular localization
Secreted. - Information by UniProt