Recombinant Mouse Leptin Precursor protein (ab222365)
Key features and details
- Expression system: Escherichia coli
- Purity: >= 95% SDS-PAGE
- Endotoxin level:
- Suitable for: SDS-PAGE
-
Product name
Recombinant Mouse Leptin Precursor protein -
Purity
>= 95 % SDS-PAGE. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
YesNature
Recombinant-
Species
Mouse -
Sequence
MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPIL SLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLP QTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC -
Predicted molecular weight
16 kDa -
Amino acids
22 to 167 -
Additional sequence information
This product is the mature full length protein from aa 22 to 167. The signal peptide is not included.
Associated products
Specifications
Our Abpromise guarantee covers the use of ab222365 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.
Constituents: 0.1% Trifluoroacetic acid, Mannitol
Lyophilized from a sterile filtered solution.
Protein: mannitol, 2:1. -
ReconstitutionCentrifuge vial before opening. Suspend the product by gently pipetting sterile 20 mM HCl down the sides of the vial to a final concentration of 0.1 mg/ml. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaw.
Images
-
SDS-PAGE - Recombinant mouse Leptin Precursor protein (ab222365)
SDS PAGE analysis of ab222365 under non-reducing (-) and reducing (+) conditions. Stained with Coomassie Blue.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab222365 has not yet been referenced specifically in any publications.
Preparation and Storage
-
SDS-PAGE - Recombinant mouse Leptin Precursor protein (ab222365)
SDS PAGE analysis of ab222365 under non-reducing (-) and reducing (+) conditions. Stained with Coomassie Blue.
Images
-
SDS-PAGE - Recombinant mouse Leptin Precursor protein (ab222365)
SDS PAGE analysis of ab222365 under non-reducing (-) and reducing (+) conditions. Stained with Coomassie Blue.