Recombinant Mouse IL-22 protein (His tag) (ab215029)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE
-
Product name
Recombinant Mouse IL-22 protein (His tag)
See all IL-22 proteins and peptides -
Purity
> 95 % SDS-PAGE. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Mouse -
Sequence
LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGV SAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCH ISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV -
Predicted molecular weight
17 kDa including tags -
Amino acids
34 to 179 -
Tags
His tag N-Terminus -
Additional sequence information
Mature form without signal peptide. NP_058667.1
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab215029 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
Constituent: PBS
Lyophilized from 0.2 µm filtered solution. -
ReconstitutionReconstitute vial with 100 µL sterile water. Working aliquots are stable for up to 3 months when stored at -20°C.
General Info
-
Alternative names
- Cytokine Zcyto18
- IL 10 related T cell derived inducible factor
- IL 21
see all -
Function
Cytokine that contributes to the inflammatory response in vivo. -
Sequence similarities
Belongs to the IL-10 family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab215029 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.
Constituent: PBS
Lyophilized from 0.2 µm filtered solution. -
ReconstitutionReconstitute vial with 100 µL sterile water. Working aliquots are stable for up to 3 months when stored at -20°C.