Recombinant Mouse IL-22 protein (Fc Chimera) (ab214995)
Key features and details
- Expression system: CHO cells
- Purity: >= 98% SDS-PAGE
- Endotoxin level:
- Suitable for: SDS-PAGE
-
Product name
Recombinant Mouse IL-22 protein (Fc Chimera)
See all IL-22 proteins and peptides -
Purity
>= 98 % SDS-PAGE. -
Endotoxin level
Expression system
CHO cellsAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Mouse -
Sequence
LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGV SAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCH ISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV -
Predicted molecular weight
17 kDa -
Amino acids
34 to 179 -
Additional sequence information
This product is the mature full length protein from aa 34 to 179. The signal peptide is not included (NP_058667.1). Fused to the N-terminus of the Fc region of mouse IgG2a.
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab214995 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
Constituent: 100% PBS
Lyophilized from 0.2µm filtered solution. -
ReconstitutionReconstitute at 100µg/ml in sterile PBS.
General Info
-
Alternative names
- Cytokine Zcyto18
- IL 10 related T cell derived inducible factor
- IL 21
see all -
Function
Cytokine that contributes to the inflammatory response in vivo. -
Sequence similarities
Belongs to the IL-10 family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab214995 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
Constituent: 100% PBS
Lyophilized from 0.2µm filtered solution. -
ReconstitutionReconstitute at 100µg/ml in sterile PBS.