Antibodies, Proteins, Kits and Reagents for Life Science

Key features and details

Expression system: Escherichia coli
Purity: > 97% SDS-PAGE
Endotoxin level:
Active: Yes
Suitable for: SDS-PAGE, Functional Studies, HPLC

Product name

Recombinant dog IL-3 protein
See all IL-3 proteins and peptides
Biological activity

The ED₅₀ as determined by the dose-dependant stimulation of the proliferation of Human TF-1 cells is less than 0.2 ng/ml, corresponding to a specific activity of 5.0×10⁶ IU/mg.
Purity

> 97 % SDS-PAGE.
> 97 % by HPLC.
Endotoxin level
Expression system

Escherichia coli
Accession

Q9BDX4
Protein length

Full length protein
Animal free

No
Nature

Recombinant
- Species
  
  Dog
- Sequence
  
  RPFSTDLPKQYFTMINEIMEMLNKSPSPSEEPLDSNEKETLLEDTLLRPN LDVFLNASSKFHKNGLLIWNNLKEFLPLLPTPTPRGEPISIMENNWGDFQ RKLKKYLEALDNFLNFKNKP
- Predicted molecular weight
  
  14 kDa
- Amino acids
  
  24 to 143
- Additional sequence information
  
  This product is for the mature full length protein. The signal peptide is not included.

Our Abpromise guarantee covers the use of ab201436 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Applications

SDS-PAGE

Functional Studies

HPLC
Form

Lyophilized
Concentration information loading...

Stability and Storage

Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

This product is an active protein and may elicit a biological response in vivo, handle with caution.
Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL.

Alternative names
- Colony stimulating factor multiple
- Hematopoietic growth factor
- IL 3
- IL-3
- IL3
- IL3_HUMAN
- Interleukin 3
- Interleukin 3 (colony stimulating factor, multiple)
- Interleukin-3
- Mast cell growth factor
- MCGF
- MGC79398
- MGC79399
- Multi CSF
- Multilineage colony stimulating factor
- Multipotential colony stimulating factor
- Multipotential colony-stimulating factor
- OTTHUMP00000065963
- P cell stimulating factor
- P-cell-stimulating factor
see all
Function

Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.
This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.
Tissue specificity

Activated T-cells, mast cells, natural killer cells.
Sequence similarities

Belongs to the IL-3 family.
Cellular localization

Secreted.
Target information above from: UniProt accession P08700 The UniProt Consortium
The Universal Protein Resource (UniProt) in 2010
Nucleic Acids Res. 38:D142-D148 (2010) .

Information by UniProt

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols