Recombinant dog IL-3 protein (ab201436)
Key features and details
- Expression system: Escherichia coli
- Purity: > 97% SDS-PAGE
- Endotoxin level:
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies, HPLC
-
Product name
Recombinant dog IL-3 protein
See all IL-3 proteins and peptides -
Biological activity
The ED50 as determined by the dose-dependant stimulation of the proliferation of Human TF-1 cells is less than 0.2 ng/ml, corresponding to a specific activity of 5.0×106 IU/mg.
-
Purity
> 97 % SDS-PAGE.
> 97 % by HPLC. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Dog -
Sequence
RPFSTDLPKQYFTMINEIMEMLNKSPSPSEEPLDSNEKETLLEDTLLRPN LDVFLNASSKFHKNGLLIWNNLKEFLPLLPTPTPRGEPISIMENNWGDFQ RKLKKYLEALDNFLNFKNKP -
Predicted molecular weight
14 kDa -
Amino acids
24 to 143 -
Additional sequence information
This product is for the mature full length protein. The signal peptide is not included.
Specifications
Our Abpromise guarantee covers the use of ab201436 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
HPLC
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL.
General Info
-
Alternative names
- Colony stimulating factor multiple
- Hematopoietic growth factor
- IL 3
see all -
Function
Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.
This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes. -
Tissue specificity
Activated T-cells, mast cells, natural killer cells. -
Sequence similarities
Belongs to the IL-3 family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab201436 has not yet been referenced specifically in any publications.
Preparation and Storage
- Colony stimulating factor multiple
- Hematopoietic growth factor
- IL 3
