Recombinant human IL-3 protein (ab83685)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
-
Product name
Recombinant human IL-3 protein
See all IL-3 proteins and peptides -
Biological activity
Activity: The ED50 of ab83685 is typically 0.1- 0.4 ng/ml as measured using the human growth factor dependent TF1 cell line. -
Purity
> 95 % SDS-PAGE. -
Expression system
HEK 293 cells -
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
Theoretical Sequence: APMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILME NNLRRPN LEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIH IKDGDWNEFRRKLTFYL KTLENAQAQQTTLSLAIF
-
Preparation and Storage
-
Alternative names
- Colony stimulating factor multiple
- Hematopoietic growth factor
- IL 3
see all -
Function
Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.
This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes. -
Tissue specificity
Activated T-cells, mast cells, natural killer cells. -
Sequence similarities
Belongs to the IL-3 family. -
Cellular localization
Secreted. - Information by UniProt
Images
-
Functional Studies - Recombinant human IL-3 protein (ab83685)Densitometry of protein isoforms visualised by 2-DE. The triangle indicates the theoretical MW and pI of the protein.
-
SDS-PAGE - Recombinant human IL-3 protein (ab83685)1D gel data:
Lane 1 ab83685
Lane 2 ab83685 treated with PNGase F to remove potential N-linked glycans
Lane 4 ab83685 treated with a glycosidase cocktail to remove potential N- and O-linked glycans.
5 μg protein loaded per lane; Deep Purple™ stained. Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. Faint bands in lane 2 and lane 3 are glycosidase enzymes. -
SDS-PAGE - Recombinant human IL-3 protein (ab83685)2D gel data:
A sample of ab83685 without carrier protein was reduced and alkylated and focused on a 3-10 IPG strip then run on a 4-20% Tris-HCl 2D gel. 40 μg protein loaded per lane; Deep Purple™ stained.
Spot train indicates presence of multiple isoforms of ab83685.
Spots within the spot train were cut from the gel and identified as IL-3 by protein mass fingerprinting.
