Recombinant Mouse IL-31 protein (ab256058)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Suitable for: SDS-PAGE, Functional Studies
-
Product name
Recombinant Mouse IL-31 protein
See all IL-31 proteins and peptides -
Purity
> 95 % SDS-PAGE. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
YesNature
Recombinant-
Species
Mouse -
Sequence
MTCSLSFGAPISKEDLRTTIDLLKQESQDLYNNYSIKQASGMSADESIQL PCFSLDREALTNISVIIAHLEKVKVLSENTVDTSWVIRWLTNISCFNPLN LNISVPGNTDESYDCKVFVLTVLKQFSNCMAELQAKDNTTC -
Predicted molecular weight
16 kDa -
Amino acids
24 to 163 -
Additional sequence information
Full-length mature chain lacking the signal peptide.
Associated products
Specifications
Our Abpromise guarantee covers the use of ab256058 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at room temperature. Store at -20°C.
Constituent: 0.16% Sodium phosphate
0.2 micron filtered -
ReconstitutionReconstitute in sterile water at 0.1 mg/ml. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.
General Info
-
Alternative names
- IL 31
- IL-31
- IL31
see all -
Function
Activates STAT3 and possibly STAT1 and STAT5 through the IL31 heterodimeric receptor composed of IL31RA and OSMR. IL31 may function in skin immunity. -
Tissue specificity
Detected at low levels in testis, bone marrow, skeletal muscle, kidney, colon, thymus, small intestine and trachea. -
Cellular localization
Secreted. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab256058 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Alternative names
- IL 31
- IL-31
- IL31
see all -
Function
Activates STAT3 and possibly STAT1 and STAT5 through the IL31 heterodimeric receptor composed of IL31RA and OSMR. IL31 may function in skin immunity. -
Tissue specificity
Detected at low levels in testis, bone marrow, skeletal muscle, kidney, colon, thymus, small intestine and trachea. -
Cellular localization
Secreted. - Information by UniProt