Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Cancer Tumor immunology Cytokines Interleukins

Recombinant mouse IL-21 protein (Fc Chimera Active) (ab215000)

Key features and details

  • Expression system: CHO cells
  • Purity: >= 98% SDS-PAGE
  • Endotoxin level:
  • Active: Yes
  • Suitable for: SDS-PAGE, Functional Studies

You may also be interested in

Product image
Anti-IL-17C antibody - BSA and Azide free (Capture) (ab281530)
Product image
Recombinant Rat IL-10 protein (Animal Free) (ab256036)
Product image
Recombinant Rhesus monkey IL-10 protein (His tag) (ab239538)
Recombinant rat IL-15 protein (ab49905)

Description

  • Product name

    Recombinant mouse IL-21 protein (Fc Chimera Active)
    See all IL-21 proteins and peptides
  • Biological activity

    Shows the biological function of the IL21 moiety and exerts a prolonged circulating half-life caused by the modified Fc domain. Non-lytic: Acts as a long lasting fusion protein which only binds to the receptor. Mutations to the complement (C1q) and FcgR I binding sites of the IgGs Fc fragment render the fusion proteins incapable of antibody directed cytotoxicity (ADCC) and complement directed cytotoxicity (CDC).

  • Purity

    >= 98 % SDS-PAGE.

  • Endotoxin level

  • Expression system

    CHO cells
  • Accession

    ABG36530.1
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Mouse
    • Sequence

      HKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHA AFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPS CDSYEKRTPKEFLERLKWLLQKVCTLNAF
    • Amino acids

      18 to 146
    • Additional sequence information

      The extracellular domain of mouse IL21 fused to the N terminus of the Fc region of a mutant mouse IgG2a.
  • Associated products

      Specifications

      Our Abpromise guarantee covers the use of ab215000 in the following tested applications.

      The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

      • Applications

        SDS-PAGE

        Functional Studies

      • Form

        Lyophilized
      • Concentration information loading...

      Preparation and Storage

      • Stability and Storage

        Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle.

        Constituent: 100% PBS

        Lyophilized from 0.2 µm-filtered solution.

        This product is an active protein and may elicit a biological response in vivo, handle with caution.

      • Reconstitution
        Reconstitute at 100 µg/ml in sterile PBS.

      General Info

      • Alternative names

        • CVID11
        • IL 21
        • IL-21
        • Il21
        • IL21_HUMAN
        • Interleukin 21
        • Interleukin-21
        • interleukin-21 isoform
        • Interleukin21
        • OTTHUMP00000164088
        • Za11
        see all
      • Function

        Cytokine with immunoregulatory activity. May promote the transition between innate and adaptive immunity. Induces the production of IgG(1) and IgG(3) in B-cells (By similarity). May play a role in proliferation and maturation of natural killer (NK) cells in synergy with IL15. May regulate proliferation of mature B- and T-cells in response to activating stimuli. In synergy with IL15 and IL18 stimulates interferon gamma production in T-cells and NK cells. During T-cell mediated immune response may inhibit dendritic cells (DC) activation and maturation.
      • Tissue specificity

        Expressed in activated CD4-positive T-cells but not in CD8-positive T-cells, B-cells, or monocytes.
      • Sequence similarities

        Belongs to the IL-15/IL-21 family.
      • Cellular localization

        Secreted.
      • Target information above from: UniProt accession Q9HBE4 The UniProt Consortium
        The Universal Protein Resource (UniProt) in 2010
        Nucleic Acids Res. 38:D142-D148 (2010) .

        Information by UniProt

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab215000? Please let us know so that we can cite the reference in this datasheet.

    ab215000 has not yet been referenced specifically in any publications.

    Preparation and Storage

    • Alternative names

      • CVID11
      • IL 21
      • IL-21
      • Il21
      • IL21_HUMAN
      • Interleukin 21
      • Interleukin-21
      • interleukin-21 isoform
      • Interleukin21
      • OTTHUMP00000164088
      • Za11
      see all
    • Function

      Cytokine with immunoregulatory activity. May promote the transition between innate and adaptive immunity. Induces the production of IgG(1) and IgG(3) in B-cells (By similarity). May play a role in proliferation and maturation of natural killer (NK) cells in synergy with IL15. May regulate proliferation of mature B- and T-cells in response to activating stimuli. In synergy with IL15 and IL18 stimulates interferon gamma production in T-cells and NK cells. During T-cell mediated immune response may inhibit dendritic cells (DC) activation and maturation.
    • Tissue specificity

      Expressed in activated CD4-positive T-cells but not in CD8-positive T-cells, B-cells, or monocytes.
    • Sequence similarities

      Belongs to the IL-15/IL-21 family.
    • Cellular localization

      Secreted.
    • Target information above from: UniProt accession Q9HBE4 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Alternative products to Recombinant mouse IL-21 protein (Fc Chimera Active) (ab215000)

    •  
    • Recombinant Pig IL-21 protein (ab209364)

      Applications: SDS-PAGE

    •  
    • Recombinant human IL-21 protein (Animal Free) (ab217423)

      Applications: FuncS, HPLC, SDS-PAGE

    •  
    • Product image

      Recombinant human IL-21 protein (Active) (Biotin) (ab246159)

      Applications: FuncS, SDS-PAGE

    •  
    • Product image

      Recombinant human IL-21 protein (ab73250)

      Applications: FuncS, SDS-PAGE, WB

    •  
    • Recombinant human IL-21 protein (ab214152)

      Applications: FuncS, SDS-PAGE

    •  
    • Recombinant chicken IL-21 protein (Active) (ab209355)

      Applications: FuncS, SDS-PAGE

    •  
    • Recombinant Human IL-21 protein (ab60287)

      Applications: SDS-PAGE

    Clear all

    Recently viewed products

    •  
    • Product image

      Anti-CRMP2 antibody [EPR7792] (ab129082)

    •  
    • Product image

      Anti-Dishevelled 2 antibody (ab137528)

    •  
    • Product image

      Anti-ADNP antibody [102C1a] (ab54402)

    •  
    • Product image

      Biotin Anti-IL-7 antibody (ab271243)

    •  
    • Product image

      APC Anti-CD81 antibody [M38] (ab233259)

    •  
    • Product image

      Human HLA-E (HLA E) knockout A549 cell pellet (ab279240)

    Get resources and offers direct to your inbox Sign up
    © 2021 Astana Biomed Group LLP. All rights reserved.