Recombinant mouse IL-21 protein (Fc Chimera Active) (ab215000)
Key features and details
- Expression system: CHO cells
- Purity: >= 98% SDS-PAGE
- Endotoxin level:
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
-
Product name
Recombinant mouse IL-21 protein (Fc Chimera Active)
See all IL-21 proteins and peptides -
Biological activity
Shows the biological function of the IL21 moiety and exerts a prolonged circulating half-life caused by the modified Fc domain. Non-lytic: Acts as a long lasting fusion protein which only binds to the receptor. Mutations to the complement (C1q) and FcgR I binding sites of the IgGs Fc fragment render the fusion proteins incapable of antibody directed cytotoxicity (ADCC) and complement directed cytotoxicity (CDC).
-
Purity
>= 98 % SDS-PAGE. -
Endotoxin level
Expression system
CHO cellsAccession
Protein length
Protein fragmentAnimal free
NoNature
Recombinant-
Species
Mouse -
Sequence
HKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHA AFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPS CDSYEKRTPKEFLERLKWLLQKVCTLNAF -
Amino acids
18 to 146 -
Additional sequence information
The extracellular domain of mouse IL21 fused to the N terminus of the Fc region of a mutant mouse IgG2a.
Associated products
Specifications
Our Abpromise guarantee covers the use of ab215000 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle.
Constituent: 100% PBS
Lyophilized from 0.2 µm-filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute at 100 µg/ml in sterile PBS.
General Info
-
Alternative names
- CVID11
- IL 21
- IL-21
see all -
Function
Cytokine with immunoregulatory activity. May promote the transition between innate and adaptive immunity. Induces the production of IgG(1) and IgG(3) in B-cells (By similarity). May play a role in proliferation and maturation of natural killer (NK) cells in synergy with IL15. May regulate proliferation of mature B- and T-cells in response to activating stimuli. In synergy with IL15 and IL18 stimulates interferon gamma production in T-cells and NK cells. During T-cell mediated immune response may inhibit dendritic cells (DC) activation and maturation. -
Tissue specificity
Expressed in activated CD4-positive T-cells but not in CD8-positive T-cells, B-cells, or monocytes. -
Sequence similarities
Belongs to the IL-15/IL-21 family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab215000 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Alternative names
- CVID11
- IL 21
- IL-21
see all -
Function
Cytokine with immunoregulatory activity. May promote the transition between innate and adaptive immunity. Induces the production of IgG(1) and IgG(3) in B-cells (By similarity). May play a role in proliferation and maturation of natural killer (NK) cells in synergy with IL15. May regulate proliferation of mature B- and T-cells in response to activating stimuli. In synergy with IL15 and IL18 stimulates interferon gamma production in T-cells and NK cells. During T-cell mediated immune response may inhibit dendritic cells (DC) activation and maturation. -
Tissue specificity
Expressed in activated CD4-positive T-cells but not in CD8-positive T-cells, B-cells, or monocytes. -
Sequence similarities
Belongs to the IL-15/IL-21 family. -
Cellular localization
Secreted. - Information by UniProt
