Recombinant Mouse IgG2a protein (Fc fragment) (ab179982)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 90% SDS-PAGE
- Endotoxin level:
- Suitable for: SDS-PAGE
-
Product name
Recombinant Mouse IgG2a protein (Fc fragment) -
Purity
> 90 % SDS-PAGE. -
Endotoxin level
Expression system
HEK 293 cellsAccession
Protein length
Protein fragmentAnimal free
NoNature
Recombinant-
Species
Mouse -
Sequence
EPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVV DVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWM SGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVT LTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEK KNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK -
Predicted molecular weight
26 kDa -
Amino acids
98 to 330 -
Additional sequence information
Accession number; CAC20702.
Specifications
Our Abpromise guarantee covers the use of ab179982 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).
pH: 7.4
Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose
Lyophilized from 0.22 µm filtered solution. -
ReconstitutionReconstitute with sterile deionized water to a concentration of 400 µg/ml.
General Info
-
Relevance
There are four IgG subclasses (IgG1, 2, 3 and 4) in humans, named in order of their abundance in serum (IgG1 being the most abundant). The IgG2a Ig subclass plays a critical role in the pathogenesis of humoral auto-immunity and protection against pathogens. -
Cellular localization
Secreted
Images
-
SDS-PAGE - Recombinant Mouse IgG2a protein (Fc fragment) (ab179982)
The purity of ab179982 was determined by reduced (lane 1) and non-reduced (lane 2) SDS-PAGE and staining overnight with Coomassie Blue. As a result of glycosylation, reduced protein migrates as 25-30 kDa and non-reduced protein migrates as 50-60 kDa.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab179982 has not yet been referenced specifically in any publications.
Preparation and Storage
-
SDS-PAGE - Recombinant Mouse IgG2a protein (Fc fragment) (ab179982)
The purity of ab179982 was determined by reduced (lane 1) and non-reduced (lane 2) SDS-PAGE and staining overnight with Coomassie Blue. As a result of glycosylation, reduced protein migrates as 25-30 kDa and non-reduced protein migrates as 50-60 kDa.
Images
-
SDS-PAGE - Recombinant Mouse IgG2a protein (Fc fragment) (ab179982)
The purity of ab179982 was determined by reduced (lane 1) and non-reduced (lane 2) SDS-PAGE and staining overnight with Coomassie Blue. As a result of glycosylation, reduced protein migrates as 25-30 kDa and non-reduced protein migrates as 50-60 kDa.
