Recombinant Mouse CD83 protein (Fc Chimera) (ab214598)
Key features and details
- Expression system: CHO cells
- Purity: >= 98% SDS-PAGE
- Endotoxin level:
- Suitable for: SDS-PAGE
-
Product name
Recombinant Mouse CD83 protein (Fc Chimera)
See all CD83 proteins and peptides -
Purity
>= 98 % SDS-PAGE. -
Endotoxin level
Expression system
CHO cellsAccession
Protein length
Protein fragmentAnimal free
NoNature
Recombinant-
Species
Mouse -
Sequence
MREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNS SFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCP KEATESTFRKYRAE -
Predicted molecular weight
13 kDa -
Amino acids
22 to 135 -
Additional sequence information
Fused to the N-terminus of the Fc region of mouse IgG2a (NP_033986.1).
Specifications
Our Abpromise guarantee covers the use of ab214598 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Avoid freeze / thaw cycle. Stable for 12 months at -20°C.
Constituent: 100% PBS
Lyophilized from 0.2 µm-filtered solution. -
ReconstitutionReconstitute at 100 µg/mL in sterile PBS.
General Info
-
Alternative names
- B cell activation 45kDa cell surface glycoprotein Ig superfamily
- B cell activation protein
- B-cell activation protein
see all -
Function
May play a significant role in antigen presentation or the cellular interactions that follow lymphocyte activation. -
Tissue specificity
Expressed by activated lymphocytes, Langerhans cells and interdigitating reticulum cells. -
Sequence similarities
Contains 1 Ig-like V-type (immunoglobulin-like) domain. -
Cellular localization
Membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab214598 has not yet been referenced specifically in any publications.
Preparation and Storage
- B cell activation 45kDa cell surface glycoprotein Ig superfamily
- B cell activation protein
- B-cell activation protein