Recombinant Mouse BD-3 protein (Animal Free) (ab245951)
Key features and details
- Expression system: Escherichia coli
- Endotoxin level:
- Suitable for: SDS-PAGE, HPLC
-
Product name
Recombinant Mouse BD-3 protein (Animal Free)
See all BD-3 proteins and peptides -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
YesNature
Recombinant-
Species
Mouse -
Sequence
KKINNPVSCLRKGGRCWNRCIGNTRQIGSCGVPFLKCCKRK -
Predicted molecular weight
5 kDa -
Amino acids
23 to 63 -
Additional sequence information
Full length mature protein without the signal and propeptide.
Specifications
Our Abpromise guarantee covers the use of ab245951 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
HPLC
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituent: 0.1% Trifluoroacetic acid
-
ReconstitutionReconstitute in water to 0.1 - 1.0 mg/ml.
General Info
-
Alternative names
- BD 3
- BD-3
- BD3
see all -
Function
Exhibits antimicrobial activity against Gram-positive bacteria S.aureus and S.pyogenes, Gram-negative bacteria P.aeruginosa and E.coli and the yeast C.albicans. Kills multiresistant S.aureus and vancomycin-resistent E.faecium. No significant hemolytic activity was observed. -
Tissue specificity
Highly expressed in skin and tonsils, and to a lesser extent in trachea, uterus, kidney, thymus, adenoid, pharynx and tongue. Low expression in salivary gland, bone marrow, colon, stomach, polyp and larynx. No expression in small intestine. -
Sequence similarities
Belongs to the beta-defensin family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab245951 has not yet been referenced specifically in any publications.
Preparation and Storage
- BD 3
- BD-3
- BD3