Recombinant mCherry protein (His tag) (ab199750)
Key features and details
- Expression system: Escherichia coli
- Endotoxin level:
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE, HPLC
-
Product name
Recombinant mCherry protein (His tag) -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Anaplasma marginale -
Sequence
MGSSHHHHHHSSGLVPRGSHMVSKGEEDNMAIIKEFMRFKVHMEGSVNGH EFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKH PADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLR GTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDA EVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGG MDELYK -
Predicted molecular weight
29 kDa including tags -
Amino acids
1 to 236 -
Tags
His tag N-Terminus -
Additional sequence information
pI: 6.23. Ex.= 587 nm (540-590 nm); Em.= 610 nm (550-650 nm).
Associated products
-
Related Buffer
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab199750 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
HPLC
-
Form
Lyophilized -
Additional notes
mCherry is the second generation monomeric red fluorescent protein that has improved brightness and photostability. The protein is suitable as a positive control for mCherry protein expression studies or as a labeling reagent. The recombinant mCherry protein is ideal for fusion tag applications and is perfect for triple labeling with EGFP, CFP, YFP, or any other dyes. The protein is engineered with 6xHis-tag on the N-terminus, which can be used for detection with anti-His-Tag antibody or protein purification/removal by using Ni++ beads.
Endotoxin level:
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Please see notes section.
-
ReconstitutionReconstitute with dH2O to 1 mg/ml. Aliquot and store at -80°C for long-term storage. Avoid freeze thaw cycles.
General Info
-
Relevance
mCherry is derived from proteins originally isolated from Cnidarians (jelly fish, sea anemones and corals), and is used as a fluorescent tracer in trasfection and transgenic experiments. The prototype for these fluorescent proteins is Green Fluorescent Protein (GFP), which is a ~27kDa protein isolated originally from the jellyfish Aequoria victoria. The mCherry protein is derived from DsRed, a red fluorescent protein related to GFP isolated from so-called disc corals of the genus Discosoma.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (1)
ab199750 has been referenced in 1 publication.
- Guo M et al. Inhibition of allogeneic islet graft rejection by VISTA-conjugated liposome. Biochem Biophys Res Commun 516:914-920 (2019). PubMed: 31272717
Preparation and Storage
-
Applications
SDS-PAGE
HPLC
-
Form
Lyophilized -
Additional notes
mCherry is the second generation monomeric red fluorescent protein that has improved brightness and photostability. The protein is suitable as a positive control for mCherry protein expression studies or as a labeling reagent. The recombinant mCherry protein is ideal for fusion tag applications and is perfect for triple labeling with EGFP, CFP, YFP, or any other dyes. The protein is engineered with 6xHis-tag on the N-terminus, which can be used for detection with anti-His-Tag antibody or protein purification/removal by using Ni++ beads.
Endotoxin level:
-
Concentration information loading...