Recombinant Human UBAP1 protein (ab152036)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Tags: His tag C-Terminus
- Suitable for: SDS-PAGE
-
Product name
Recombinant Human UBAP1 protein -
Purity
> 95 % SDS-PAGE. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
MASKKLGADFHGTFSYLDDVPFKTGDKFKTPAKVGLPIGFSLPDCLQVVR EVQYDFSLEKKTIEWAEEIKKIEEAEREAECKIAEAEAKVNSKSGPEGDS KMSFSKTHSTATMPPPINPILASLQHNSILTPTRVSSSATKQKVLSPPHI KADFNLADFECEEDPFDNLELKTIDEKEELRNILVGTTGPIMAQLLDNNL PRGGSGSVLQDEEVLASLERATLDFKPLHKPNGFITLPQLGNCEKMSLSS KVSLPPIPAVSNIKSLSFPKLDSDDSNQKTAKLASTFHSTSCLRNGTFQN SLKPSTQSSASELNGHHTLGLSALNLDSGTEMPALTSSQMPSLSVLSVCT EESSPPNTGPTVTPPNFSVSQVPNMPSCPQAYSELQMLSPSERQCVETVV NMGYSYECVLRAMKKKGENIEQILDYLFAHGQLCEKGFDPLLVEEALEMH QCSEEKMMEFLQLMSKFKEMGFELKDIKEVLLLHNNDQDNALEDLMARAG AS -
Predicted molecular weight
55 kDa -
Amino acids
1 to 502 -
Tags
His tag C-Terminus
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab152036 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Additional notes
Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C. Please see notes section.
pH: 7.40
Constituents: 99% Phosphate Buffer, 0.02% DTT, 0.88% Sodium chloride -
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
General Info
-
Alternative names
- MGC8710
- NAG20
- Nasopharyngeal carcinoma associated gene 20 protein
see all -
Relevance
This gene is a member of the UBA domain family, whose members include proteins having connections to ubiquitin and the ubiquitination pathway. The ubiquitin associated domain is thought to be a non-covalent ubiquitin binding domain consisting of a compact three helix bundle. This particular protein originates from a gene locus in a refined region on chromosome 9 undergoing loss of heterozygosity in nasopharyngeal carcinoma (NPC). Taking into account its cytogenetic location, this UBA domain family member is being studied as a putative target for mutation in nasopharyngeal carcinomas. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. -
Cellular localization
Cytoplasm; cytosol. Endosome. Note: Predominantly cytosolic. Recruited to endosomes as part of the ESCRT-I complex.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab152036 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C. Please see notes section.
pH: 7.40
Constituents: 99% Phosphate Buffer, 0.02% DTT, 0.88% Sodium chloride -
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.