Recombinant Human TLR9 protein (ab153365)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: ELISA, WB
-
Product name
Recombinant Human TLR9 protein -
Expression system
Wheat germ -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
PPVGLSPMHFPCHMTIEPSTFLAVPTLEELNLSYNNIMTVPALPKSLISL SLSHTNILMLDSASLAGLHALRFLFMDGNCYYKNPCRQALEVAPGALLGL GNLTHLSLKYNNLTVVP -
Amino acids
99 to 215 -
Tags
GST tag N-Terminus
-
Preparation and Storage
-
Alternative names
- CD 289
- CD289
- TLR 9
see all -
Function
Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific of microorganisms. TLR9 is a nucleotide-sensing TLR which is activated by unmethylated cytidine-phosphate-guanosine (CpG) dinucleotides. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. -
Tissue specificity
Highly expressed in spleen, lymph node, tonsil and peripheral blood leukocytes, especially in plasmacytoid pre-dendritic cells. Levels are much lower in monocytes and CD11c+ immature dendritic cells. Also detected in lung and liver. -
Sequence similarities
Belongs to the Toll-like receptor family.
Contains 26 LRR (leucine-rich) repeats.
Contains 1 TIR domain. -
Cellular localization
Endoplasmic reticulum membrane. Endosome. Lysosome. Cytoplasmic vesicle > phagosome. Relocalizes from endoplasmic reticulum to endosome and lysosome upon stimulation with agonist. - Information by UniProt
Images
-
SDS-PAGE - Recombinant Human TLR9 protein (ab153365)ab153365 on a 12.5% SDS-PAGE stained with Coomassie Blue.