Recombinant Human PEA15 protein (ab172828)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Suitable for: SDS-PAGE, HPLC
-
Product name
Recombinant Human PEA15 protein
See all PEA15 proteins and peptides -
Purity
> 95 % SDS-PAGE.
ab172828 is greater than 95% pure, as determined by SEC-HPLC and reducing SDS-PAGE. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
GSHMAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFS FLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDT KLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA -
Predicted molecular weight
15 kDa -
Amino acids
1 to 130
Specifications
Our Abpromise guarantee covers the use of ab172828 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
HPLC
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituent: 100% PBS
Supplied as a 0.2 µM filtered solution
General Info
-
Alternative names
- 15 kDa phosphoprotein enriched in astrocytes
- Astrocytic phosphoprotein PEA 15
- Astrocytic phosphoprotein PEA-15
see all -
Function
Blocks Ras-mediated inhibition of integrin activation and modulates the ERK MAP kinase cascade. Inhibits RPS6KA3 activities by retaining it in the cytoplasm (By similarity). Inhibits both TNFRSF6- and TNFRSF1A-mediated CASP8 activity and apoptosis. Regulates glucose transport by controlling both the content of SLC2A1 glucose transporters on the plasma membrane and the insulin-dependent trafficking of SLC2A4 from the cell interior to the surface. -
Tissue specificity
Ubiquitously expressed. Most abundant in tissues such as heart, brain, muscle and adipose tissue which utilize glucose as an energy source. Lower expression in glucose-producing tissues. Higher levels of expression are found in tissues from individuals with type 2 diabetes than in controls. -
Sequence similarities
Contains 1 DED (death effector) domain. -
Post-translational
modificationsPhosphorylated by protein kinase C and calcium-calmodulin-dependent protein kinase. These phosphorylation events are modulated by neurotransmitters or hormones. -
Cellular localization
Cytoplasm. Associated with microtubules. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab172828 has not yet been referenced specifically in any publications.
Preparation and Storage
- 15 kDa phosphoprotein enriched in astrocytes
- Astrocytic phosphoprotein PEA 15
- Astrocytic phosphoprotein PEA-15