Recombinant human IL-7 protein (Fc Chimera) (ab214592)
Key features and details
- Expression system: CHO cells
- Purity: >= 98% SDS-PAGE
- Endotoxin level:
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE
-
Product name
Recombinant human IL-7 protein (Fc Chimera)
See all IL-7 proteins and peptides -
Biological activity
The Fc-protein was measured in a cell proliferation assay using antibody against CD3-activated human peripheral blood lymphocytes (PBL). The ED50 for this effect is typically 10-100ng/ml.
-
Purity
>= 98 % SDS-PAGE. -
Endotoxin level
Expression system
CHO cellsAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDAN KEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRK PAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTK EH -
Predicted molecular weight
17 kDa -
Amino acids
26 to 177 -
Additional sequence information
This product is for the mature full length protein. The signal peptide is not included. It is fused to the N-terminus of the Fc portion of a mutant Human IgG1 (AAH47698.1).
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab214592 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Stable for 12 months at -20°C.
Constituent: PBS
0.2µm-filteredThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute vial in 50 µL sterile water. Add 1X PBS to the desired protein concentration. Working aliquots are stable for up to 3 months when stored at -20°C.
General Info
-
Alternative names
- IL 7
- IL-7
- Il7
see all -
Function
Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation. -
Sequence similarities
Belongs to the IL-7/IL-9 family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab214592 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C long term. Stable for 12 months at -20°C.
Constituent: PBS
0.2µm-filteredThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute vial in 50 µL sterile water. Add 1X PBS to the desired protein concentration. Working aliquots are stable for up to 3 months when stored at -20°C.