Recombinant Human IL-29 protein (ab256025)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Suitable for: SDS-PAGE
-
Product name
Recombinant Human IL-29 protein
See all IL-29 proteins and peptides -
Purity
> 95 % SDS-PAGE. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Protein fragmentAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
MPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSP VFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTL HHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTF NLFRLLTRDLKYVADGNLCLRTSTHPEST -
Predicted molecular weight
20 kDa -
Amino acids
22 to 200
Associated products
Specifications
Our Abpromise guarantee covers the use of ab256025 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at room temperature. Store at -20°C.
Constituent: 0.1% Trifluoroacetic acid
0.2 micron filtered -
ReconstitutionReconstitute in sterile water at 0.1 mg/ml. Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.
General Info
-
Alternative names
- Cytokine ZCYTO21
- IFN lambda 1
- IFN-lambda-1
see all -
Function
Cytokine with immunomodulatory activity. May play a role in antiviral immunity. Up-regulates MHC class I antigen expression. Ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IL28RA. The ligand/receptor complex seems to signal through the Jak-STAT pathway. -
Sequence similarities
Belongs to the IL-28/IL-29 family. -
Cellular localization
Secreted. - Information by UniProt
Images
-
SDS-PAGE - Human IL-29 protein (ab256025)
SDS-PAGE analysis of ab256025 (1μg) under reducing (Lane 1) and non-reducing (Lane 2) conditions.
Human IL-29 is predicted to have a MW of 19.9kDa.
4-20% Tris-Glycine gel. Coomassie Blue staining.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab256025 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Alternative names
- Cytokine ZCYTO21
- IFN lambda 1
- IFN-lambda-1
see all -
Function
Cytokine with immunomodulatory activity. May play a role in antiviral immunity. Up-regulates MHC class I antigen expression. Ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IL28RA. The ligand/receptor complex seems to signal through the Jak-STAT pathway. -
Sequence similarities
Belongs to the IL-28/IL-29 family. -
Cellular localization
Secreted. - Information by UniProt
Images
-
SDS-PAGE - Human IL-29 protein (ab256025)
SDS-PAGE analysis of ab256025 (1μg) under reducing (Lane 1) and non-reducing (Lane 2) conditions.
Human IL-29 is predicted to have a MW of 19.9kDa.
4-20% Tris-Glycine gel. Coomassie Blue staining.