Recombinant Human IL-21R protein (Fc Chimera) (ab214127)
Key features and details
- Expression system: CHO cells
- Purity: >= 98% SDS-PAGE
- Endotoxin level:
- Suitable for: SDS-PAGE
-
Product name
Recombinant Human IL-21R protein (Fc Chimera)
See all IL-21R proteins and peptides -
Purity
>= 98 % SDS-PAGE. -
Endotoxin level
Expression system
CHO cellsAccession
Protein length
Protein fragmentAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
CPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHR SAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIK PAPPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAV SPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSD PVIFQTQSEELKE -
Predicted molecular weight
25 kDa -
Amino acids
20 to 232 -
Additional sequence information
The extracellular domain of Human IL-21Receptor fused to the N-terminus of the Fc region of Human IgG1 (NP_851564.1).
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab214127 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C. Avoid freeze / thaw cycle.
Constituent: 100% PBS
0.2µm-filtered. -
ReconstitutionReconstitute with 100 µl sterile water. Add 1X PBS to the desired protein concentration.
General Info
-
Alternative names
- CD360
- IL 21R
- IL-21 receptor
see all -
Function
This is a receptor for interleukin-21. -
Tissue specificity
Selectively expressed in lymphoid tissues. Most highly expressed in thymus and spleen. -
Sequence similarities
Belongs to the type I cytokine receptor family. Type 4 subfamily.
Contains 2 fibronectin type-III domains. -
Domain
The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
The box 1 motif is required for JAK interaction and/or activation. -
Post-translational
modificationsC-mannosylated at Trp-214 in the WSXWS motif, the sugar chain makes extensive hydrogen bonds with Asn-73 sugar, and bridges the two fibronectin domains transforming the V-shaped receptor into an A-frame. -
Cellular localization
Membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab214127 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C. Avoid freeze / thaw cycle.
Constituent: 100% PBS
0.2µm-filtered. -
ReconstitutionReconstitute with 100 µl sterile water. Add 1X PBS to the desired protein concentration.