Recombinant Human IL-15RA protein (ab114831)
Key features and details
- Expression system: Wheat germ
- Suitable for: ELISA, SDS-PAGE, WB
-
Product name
Recombinant Human IL-15RA protein
See all IL-15RA proteins and peptides -
Expression system
Wheat germ -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKA TNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPA -
Predicted molecular weight
37 kDa including tags -
Amino acids
31 to 130
-
Preparation and Storage
-
Alternative names
- AA690181
- CD215
- I15RA_HUMAN
see all -
Function
Receptor for interleukin-15. Expression of different isoforms may alter or interfere with signal transduction. Isoform 5, isoform 6, isoform 7 and isoform 8 do not bind IL15. Signal transduction involves STAT3, STAT5, STAT6, JAK2 (By similarity) and SYK. -
Tissue specificity
Isoform 1, isoform 3, isoform 4, isoform 5, isoform 6, isoform 7, isoform 8 and isoform 9 are widely expressed. Expressed in fetal brain with higher expression in the hippocampus and cerebellum than in cortex and thalamus. Higher levels of soluble sIL-15RA form in comparison with membrane-bound forms is present in all brain structures. -
Sequence similarities
Contains 1 Sushi (CCP/SCR) domain. -
Post-translational
modificationsA soluble form (sIL-15RA) arises from proteolytic shedding of the membrane-anchored receptor. The cleavage involves ADAM17/TACE (By similarity). It also binds IL-15 and thus interferes with IL-15 binding to the membrane receptor.
Phosphorylated by activated SYK.
N-glycosylated and O-glycosylated. -
Cellular localization
Secreted > extracellular space; Membrane. Nucleus membrane. Mainly found associated with the nuclear membrane and Endoplasmic reticulum membrane. Golgi apparatus membrane. Cytoplasmic vesicle membrane. Membrane. Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the nuclear membrane. - Information by UniProt