Recombinant Human HUS1 protein (ab152054)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Endotoxin level:
- Suitable for: SDS-PAGE
-
Product name
Recombinant Human HUS1 protein
See all HUS1 proteins and peptides -
Purity
> 95 % SDS-PAGE.
Purity is greater than 95% as determined by reducing SDS-PAGE. ab152054 is 0.2 µM filtered. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Full length proteinAnimal free
NoNature
Recombinant-
Species
Human -
Sequence
MKFRAKIVDGACLNHFTRISNMIAKLAKTCTLRISPDKLNFILCDKLANG GVSMWCELEQENFFNEFQMEGVSAENNEIYLELTSENLSRALKTAQNARA LKIKLTNKHFPCLTVSVELLSMSSSSRIVTHDIPIKVIPRKLWKDLQEPV VPDPDVSIYLPVLKTMKSVVEKMKNISNHLVIEANLDGELNLKIETELVC VTTHFKDLGNPPLASESTHEDRNVEHMAEVHIDIRKLLQFLAGQQVNPTK ALCNIVNNKMVHFDLLHEDVSLQYFIPALS -
Predicted molecular weight
32 kDa -
Amino acids
1 to 280
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab152054 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -20ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.32% Tris HCl, 40% Glycerol, 0.58% Sodium chloride
General Info
-
Alternative names
- Checkpoint protein HUS1
- hHUS1
- Hus1
see all -
Function
Component of the 9-1-1 cell-cycle checkpoint response complex that plays a major role in DNA repair. The 9-1-1 complex is recruited to DNA lesion upon damage by the RAD17-replication factor C (RFC) clamp loader complex. Acts then as a sliding clamp platform on DNA for several proteins involved in long-patch base excision repair (LP-BER). The 9-1-1 complex stimulates DNA polymerase beta (POLB) activity by increasing its affinity for the 3'-OH end of the primer-template and stabilizes POLB to those sites where LP-BER proceeds; endonuclease FEN1 cleavage activity on substrates with double, nick, or gap flaps of distinct sequences and lengths; and DNA ligase I (LIG1) on long-patch base excision repair substrates. -
Tissue specificity
Ubiquitous. -
Sequence similarities
Belongs to the HUS1 family. -
Cellular localization
Nucleus. Cytoplasm. In discrete nuclear foci upon DNA damage. According to PubMed:14500360, localized also in the cytoplasm. DNA damage induces its nuclear translocation. Shuttles between the nucleus and the cytoplasm. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab152054 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -20ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.32% Tris HCl, 40% Glycerol, 0.58% Sodium chloride