Recombinant human GM-CSF protein (ab88382)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: WB, Functional Studies, SDS-PAGE
-
Product name
Recombinant human GM-CSF protein
See all GM-CSF proteins and peptides -
Biological activity
Activity: The ED50 of ab88382 is typically 0.02 - 0.2 ng/ml as measured in a cell proliferation assay using the human growth factor-dependent TF-1 cell line. -
Purity
> 95 % SDS-PAGE. -
Expression system
HEK 293 cells -
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
APARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMF D LQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPET SC ATQIITFESFKENLKDFLLVIPFDCWEPVQE
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.
Constituents: 1% Human serum albumin, 10% Trehalose
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Images
-
SDS-PAGE - Recombinant human GM-CSF protein (ab88382)1D SDS-PAGE of ab88382 before and after treatment with glycosidases to remove oligosaccharides.
Lane 1: ab88382
Lane 2: ab88382 treated with PNGase F to remove potential N-linked glycans
Lane 3: ab88382 treated with a glycosidase cocktail to remove potential N- and O-linked glycans. Drop in MWt after treatment with PNGase F indicates the presence of N-linked glycans. Subsequent small drop in MWt after treatment with glycosidase cocktail suggests possible presence of O-linked glycans. Additional bands in lane 2 and lane 3 are glycosidase enzymes. -
SDS-PAGE - Recombinant human GM-CSF protein (ab88382)A sample of ab88382 without carrier protein was reduced and alkylated. 40 μg protein was loaded, focused on a 3-10 IPG strip then run on a 4-20% Tris-HCl 2D gel. Spot trains (Deep Purple™ stained) indicates the presence of multiple isoforms of GM-CSF. -
Functional Studies - Recombinant human GM-CSF protein (ab88382)Densitometry of protein isoforms visualised by 2-DE.
The densitometry scan demonstrates the purified human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.
The triangle indicates the theoretical MWt and pI of the protein.
