Recombinant human FKBP25 protein (ab93683)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE
-
Product name
Recombinant human FKBP25 protein -
Biological activity
Biological activity: Specific activity is > 490 nmoles/min/mg, and is defined as the amount of enzyme that cleaves 1 µmole of suc-AAFP-pNA per minute at 25°C in Tris-Hcl pH8.0 using chymotrypsin.Activity Assay
- Prepare 170 µl assay buffer into a suitable container and pre-chill on ice before use: The final concentrations are 200 mM Tris-Hcl, pH 8.0, and 20nM chymotrypsin.
- Add 10 µl of recombinant FKBP3 protein with 1 µg in assay buffer.
- Mix by inversion and equilibrate to 1°C and monitor the A405nm until the value is constant using a spectrophotometer.
- Add 20 µl pre-chilled 5mM suc-AAFP-pNA. (Substrate was dissolved in TFE that contained 460mM LiCl to a concentration of 3 mM)
- Record the increase in A405 nm for 30 minutes at 25°C.
-
Purity
> 90 % SDS-PAGE.
ab93683 is purified using conventional chromatography techniques. -
Expression system
Escherichia coli -
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNV AKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKS EETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQ TSAKKKKNAKPSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKK GQPDAKIPPNAKLTFEVELVDID
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
pH: 8.00
Constituents: 0.0154% DTT, 0.316% Tris HCl, 10% Glycerol (glycerin, glycerine)This product is an active protein and may elicit a biological response in vivo, handle with caution.
Images
-
SDS-PAGE - Recombinant human FKBP25 protein (ab93683)15% SDS-PAGE showing ab93683 at approximately 25 kDa (3 µg).