Recombinant human Cripto1/CRIPTO protein (ab84064)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Active: Yes
- Suitable for: SDS-PAGE
-
Product name
Recombinant human Cripto1/CRIPTO protein
See all Cripto1/CRIPTO proteins and peptides -
Biological activity
ab84064 has been shown to stimulate MAPK phosphorylation in HUVEC cells. 200ng/ml is sufficient to stimulate phosphorylation. -
Purity
> 95 % SDS-PAGE. -
Expression system
HEK 293 cells -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
Theoretical sequence: LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPP MGIQHSKELN RTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGS VPHDTWLPKKC SLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPE LPPS -
Amino acids
31 to 169
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.
Constituents: 1% Human serum albumin, 10% Trehalose
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, with longer-term sto rage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
Images
-
SDS-PAGE - Recombinant human Cripto1/CRIPTO protein (ab84064)Lane 1- MW markers; Lane 2- ab84064 ; Lane 3- ab84064 treated with PNGase F to remove potential N-linked glycans; Lane 4- ab84064 treated with a glycosidase cocktail to remove potential N- and O-linked glycans. Approximately 5 μg of protein was loaded per lane; Gel was stained using Coomassie.
A drop in MW after treatment with PNGase F indicates presence of N-linked glycans. A further drop in MW after treatment with the glycosidase cocktail indicates the presence of O-linked glycans. Additional bands in lane 3 and lane 4 are glycosidase enzymes.
O-fucosylation at Thr-88 has been confirmed.
