Recombinant human Cripto1/CRIPTO protein (Tagged) (ab190395)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Active: Yes
- Suitable for: SDS-PAGE
-
Product name
Recombinant human Cripto1/CRIPTO protein (Tagged)
See all Cripto1/CRIPTO proteins and peptides -
Biological activity
Measured by its binding ability in a functional ELSA. Immobilized recombinant Human Nodal protein at 2µg/ml (100µl/well) can bind rhCripto-1 with a linear range of 0.5-100 ng/ml.
-
Purity
> 90 % SDS-PAGE.
ab190395 was refolded using a unique temperature shift inclusion body refolding technology and chromatographically purified. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MASMTGGQQMGRGHHHHHHGNLYFQGGEFLGHQEFARPSRGYLAFRDDSI WPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSF YGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCD -
Predicted molecular weight
17 kDa including tags -
Amino acids
31 to 150 -
Additional sequence information
Full length protein without signal peptide or propeptide. Constructed with a small T7-His-TEV cleavage site Tag (29 amino acids) fusion at the N-terminal.
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituent: 0.32% Tris HCl
Contains NaCl, EDTA, KCl, arginine, DTT and glycerol.This product is an active protein and may elicit a biological response in vivo, handle with caution.
