Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Signaling Pathway G Protein Signaling Small G Proteins Other

Recombinant Human Chemerin protein (ab104356)

Key features and details

  • Expression system: Escherichia coli
  • Purity: > 98% SDS-PAGE
  • Endotoxin level:
  • Suitable for: Functional Studies, SDS-PAGE

You may also be interested in

Product image
Anti-PLK1 antibody (ab235193)
Product image
Human GMNN (Geminin) knockout HeLa cell lysate (ab257450)
Jurkat membrane extract lysate (ab30130)
Product image
Anti-p38 gamma/MAPK12 antibody [EPR6528(N)] - BSA and Azide free (ab251440)

Description

  • Product name

    Recombinant Human Chemerin protein
    See all Chemerin proteins and peptides
  • Biological activity

    Determined by its ability to chemoattract human immature dendritic cells using a concentration range of 1.0-100.0 ng/ml.
  • Purity

    > 98 % SDS-PAGE.
    Purity > 98% by SDS-PAGE gel and HPLC analyses. Sterile filtered through a 0.2 micron filter.
  • Endotoxin level

  • Expression system

    Escherichia coli
  • Accession

    Q99969
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEF KLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIE TQVLREAEEHQETQCLRVQRAGEDPHSFYFPGQFA
    • Predicted molecular weight

      16 kDa
    • Amino acids

      21 to 155
  • Associated products

      Specifications

      Our Abpromise guarantee covers the use of ab104356 in the following tested applications.

      The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

      • Applications

        Functional Studies

        SDS-PAGE

      • Form

        Lyophilized
      • Additional notes

        Determined by its ability to chemoattract human immature dendritic cells using a concentration range of 1.0-100.0 ng/ml.

        Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.

      • Concentration information loading...

      Preparation and Storage

      • Stability and Storage

        Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Please see notes section.

      • Reconstitution
        Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.

      General Info

      • Alternative names

        • HP10433
        • RAR responsive protein TIG2
        • RAR-responsive protein TIG2
        • RARR2_HUMAN
        • RARRES2
        • Retinoic acid receptor responder (tazarotene induced) 2
        • Retinoic acid receptor responder 2
        • Retinoic acid receptor responder protein 2
        • Tazarotene induced gene 2 protein
        • Tazarotene-induced gene 2 protein
        • TIG2
        see all
      • Tissue specificity

        Highly expressed in skin (basal and suprabasal layers of the epidermis, hair follicles and endothelial cells). Also found in pancreas, liver, spleen, prostate, ovary, small intestine and colon.
      • Cellular localization

        Secreted.
      • Target information above from: UniProt accession Q99969 The UniProt Consortium
        The Universal Protein Resource (UniProt) in 2010
        Nucleic Acids Res. 38:D142-D148 (2010) .

        Information by UniProt

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (1)

    Publishing research using ab104356? Please let us know so that we can cite the reference in this datasheet.

    ab104356 has been referenced in 1 publication.

    • Tobin SW  et al. Heart Failure and MEF2 Transcriptome Dynamics in Response to ß-Blockers. Sci Rep 7:4476 (2017). PubMed: 28667250

    Preparation and Storage

    • Alternative names

      • HP10433
      • RAR responsive protein TIG2
      • RAR-responsive protein TIG2
      • RARR2_HUMAN
      • RARRES2
      • Retinoic acid receptor responder (tazarotene induced) 2
      • Retinoic acid receptor responder 2
      • Retinoic acid receptor responder protein 2
      • Tazarotene induced gene 2 protein
      • Tazarotene-induced gene 2 protein
      • TIG2
      see all
    • Tissue specificity

      Highly expressed in skin (basal and suprabasal layers of the epidermis, hair follicles and endothelial cells). Also found in pancreas, liver, spleen, prostate, ovary, small intestine and colon.
    • Cellular localization

      Secreted.
    • Target information above from: UniProt accession Q99969 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Alternative products to Recombinant Human Chemerin protein (ab104356)

    •  
    • Recombinant human Chemerin protein (ab124314)

      Applications: FuncS, HPLC, SDS-PAGE

    •  
    • Product image

      Recombinant Human Chemerin protein (denatured) (ab156357)

      Applications: SDS-PAGE

    •  
    • Product image

      Recombinant Human Chemerin protein (His tag) (ab224790)

      Applications: SDS-PAGE

    Clear all

    Recently viewed products

    •  
    • Product image

      Anti-PPAR alpha antibody (ab126285)

    •  
    • Product image

      Anti-KDS antibody (ab70297)

    •  
    • Product image

      Anti-DNASE2 antibody (ab115233)

    •  
    • Product image

      Anti-C4d antibody (ab74534)

    •  
    • Product image

      Recombinant Human TET1 protein (ab140810)

    •  
    • Recombinant human Chemerin protein (ab124314)

    Get resources and offers direct to your inbox Sign up
    © 2021 Astana Biomed Group LLP. All rights reserved.