• Product name

  Recombinant Human CCN3 protein
  See all CCN3 proteins and peptides

• Purity

  > 90 % SDS-PAGE.
  
  

• Expression system

  Escherichia coli

• Protein length

  Protein fragment

• Animal free

  No

• Nature

  Recombinant

• • Species

    Human

  • Sequence

    KGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTI QAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM

  • Amino acids

    260 to 357

• Alternative names

  • CCN family member 3
  • CCN3
  • IBP-9

  • IGF-binding protein 9
  • IGFBP-9
  • IGFBP9
  • Insulin-like growth factor-binding protein 9
  • Nephroblastoma overexpressed
  • Nephroblastoma overexpressed gene protein homolog
  • Nephroblastoma-overexpressed gene protein homolog
  • NOV
  • NOV_HUMAN
  • NovH
  • Protein NOV homolog

  see all

• Function

  Immediate-early protein likely to play a role in cell growth regulation.

• Tissue specificity

  Expressed in bone marrow, thymic cells and nephroblastoma. Increased expression in Wilms tumor of the stromal type.

• Sequence similarities

  Belongs to the CCN family.
  Contains 1 CTCK (C-terminal cystine knot-like) domain.
  Contains 1 IGFBP N-terminal domain.
  Contains 1 TSP type-1 domain.
  Contains 1 VWFC domain.

• Cellular localization

  Secreted.

• Target information above from: UniProt accession P48745 The UniProt Consortium
  The Universal Protein Resource (UniProt) in 2010
  Nucleic Acids Res. 38:D142-D148 (2010) .

  Information by UniProt