Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Cancer Tumor immunology Cytokines

Recombinant human c-Kit (mutated V560G + D816V) protein (ab182832)

Recombinant human c-Kit (mutated V560G + D816V) protein (ab182832)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Expression system: Baculovirus infected Sf9 cells
  • Purity: > 80% Densitometry
  • Active: Yes
  • Tags: proprietary tag N-Terminus
  • Suitable for: SDS-PAGE, Functional Studies

You may also be interested in

Product image
Anti-IL-23R antibody (ab53656)
Anti-c-Kit antibody (ab115801)
Product image
Recombinant Human c-Kit protein (Tagged) (ab267952)
Product image
Recombinant human c-Kit (mutated V654A) protein (Active) (ab271470)

Description

  • Product name

    Recombinant human c-Kit (mutated V560G + D816V) protein
    See all c-Kit proteins and peptides
  • Biological activity

    The specific activity of ab182832 was determined to be 90 nmol/min/mg.

  • Purity

    > 80 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

    P10721
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      TYKYLQKPMYEVQWKVGEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGK TLGAGAFGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKV LSYLGNHMNIVNLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFICSK QEDHAEAALYKNLLHSKESSCSDSTNEYMDMKPGVSYVVPTKADKRRSVR IGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGMAFLASKNCIHRDL AARNILLTHGRITKICDFGLARGIKNDSNYVVKGNARLPVKWMAPESIFN CVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPE HAPAEMYDIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCS PNRQKPVVDHSVRINSVGSTASSSQPLLVHDDV
    • Predicted molecular weight

      73 kDa including tags
    • Amino acids

      544 to 976
    • Modifications

      mutated V560G + D816V
    • Tags

      proprietary tag N-Terminus

Preparation and Storage

  • Alternative names

    • C Kit
    • c-Kit
    • c-Kit Ligand
    • CD117
    • Kit
    • Kit Ligand
    • KIT oncogene
    • KIT proto oncogene receptor tyrosine kinase
    • KIT_HUMAN
    • Mast cell growth factor receptor
    • Mast/stem cell growth factor receptor Kit
    • MGF
    • p145 c-kit
    • PBT
    • Piebald trait protein
    • Proto oncogene c Kit
    • Proto oncogene tyrosine protein kinase Kit
    • Proto-oncogene c-Kit
    • SCF Receptor
    • SCFR
    • soluble KIT variant 1
    • Steel Factor Receptor
    • Stem cell factor receptor
    • tyrosine protein kinase Kit
    • Tyrosine-protein kinase Kit
    • v kit Hardy Zuckerman 4 feline sarcoma viral oncogene homolog
    • v kit Hardy Zuckerman 4 feline sarcoma viral oncogene like protein
    • v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
    see all
  • Function

    Tyrosine-protein kinase that acts as cell-surface receptor for the cytokine KITLG/SCF and plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. In response to KITLG/SCF binding, KIT can activate several signaling pathways. Phosphorylates PIK3R1, PLCG1, SH2B2/APS and CBL. Activates the AKT1 signaling pathway by phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase. Activated KIT also transmits signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. Promotes activation of STAT family members STAT1, STAT3, STAT5A and STAT5B. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KIT signaling is modulated by protein phosphatases, and by rapid internalization and degradation of the receptor. Activated KIT promotes phosphorylation of the protein phosphatases PTPN6/SHP-1 and PTPRU, and of the transcription factors STAT1, STAT3, STAT5A and STAT5B. Promotes phosphorylation of PIK3R1, CBL, CRK (isoform Crk-II), LYN, MAPK1/ERK2 and/or MAPK3/ERK1, PLCG1, SRC and SHC1.
  • Tissue specificity

    Isoform 1 and isoform 2 are detected in spermatogonia and Leydig cells. Isoform 3 is detected in round spermatids, elongating spermatids and spermatozoa (at protein level). Widely expressed. Detected in the hematopoietic system, the gastrointestinal system, in melanocytes and in germ cells.
  • Involvement in disease

    Piebald trait
    Gastrointestinal stromal tumor
    Testicular germ cell tumor
    Leukemia, acute myelogenous
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
    Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Ubiquitinated by SOCS6. KIT is rapidly ubiquitinated after autophosphorylation induced by KITLG/SCF binding, leading to internalization and degradation.
    Autophosphorylated on tyrosine residues. KITLG/SCF binding enhances autophosphorylation. Isoform 1 shows low levels of tyrosine phosphorylation in the absence of added KITLG/SCF (in vitro). Kinase activity is down-regulated by phosphorylation on serine residues by protein kinase C family members. Phosphorylation at Tyr-568 is required for interaction with PTPN11/SHP-2, CRK (isoform Crk-II) and members of the SRC tyrosine-protein kinase family. Phosphorylation at Tyr-570 is required for interaction with PTPN6/SHP-1. Phosphorylation at Tyr-703, Tyr-823 and Tyr-936 is important for interaction with GRB2. Phosphorylation at Tyr-721 is important for interaction with PIK3R1. Phosphorylation at Tyr-823 and Tyr-936 is important for interaction with GRB7.
  • Cellular localization

    Cell membrane and Cytoplasm. Detected in the cytoplasm of spermatozoa, especially in the equatorial and subacrosomal region of the sperm head.
  • Target information above from: UniProt accession P10721 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • Functional Studies - Recombinant human c-Kit (mutated V560G + D816V) protein (ab182832)
    Functional Studies - Recombinant human c-Kit (mutated V560G + D816V) protein (ab182832)
    The specific activity of c-Kit (ab182832) was determined to be 31 nmol/min/mg as per activity assay protocol and was equivalent to 80 nmol/min/mg as per radiometric assay
  • SDS-PAGE - Recombinant human c-Kit (mutated V560G + D816V) protein (ab182832)
    SDS-PAGE - Recombinant human c-Kit (mutated V560G + D816V) protein (ab182832)
    SDS PAGE analysis of ab182832
  • SDS-PAGE - Recombinant human c-Kit (mutated V560G + D816V) protein (ab182832)
    SDS-PAGE - Recombinant human c-Kit (mutated V560G + D816V) protein (ab182832)
    SDS PAGE analysis of ab182832
  • Functional Studies - Recombinant human c-Kit (mutated V560G + D816V) protein (ab182832)
    Functional Studies - Recombinant human c-Kit (mutated V560G + D816V) protein (ab182832)

    Kinase Assay demonstrating specific activity of ab182832 to be 90nmol/min/mg.

  • SDS-PAGE - Recombinant human c-Kit (mutated V560G + D816V) protein (ab182832)
    SDS-PAGE - Recombinant human c-Kit (mutated V560G + D816V) protein (ab182832)

    SDS-PAGE analysis of ab182832.

     

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Recombinant human c-Kit (mutated V560G + D816V) protein (ab182832)

  •  
  • Product image

    Recombinant human c-Kit protein (ab205798)

    Applications: FuncS, SDS-PAGE

  •  
  • Product image

    Recombinant human c-Kit protein (ab83580)

    Applications: FuncS, SDS-PAGE

  •  
  • Product image

    Recombinant human c-Kit protein (Fc Chimera Active) (ab219878)

    Applications: ELISA, SDS-PAGE

  •  
  • Product image

    Recombinant human c-Kit (mutated V654A) protein (ab63179)

    Applications: FuncS, SDS-PAGE

  •  
  • Product image

    Recombinant human c-Kit protein (Fc Chimera) (ab88349)

    Applications: FuncS, SDS-PAGE

Clear all

Recently viewed products

  •  
  • Product image

    Anti-Glutathione antibody [D8] (ab19534)

  •  
  • Product image

    Anti-PD-L1 antibody [BLR020E] (ab243877)

  •  
  • Product image

    Anti-Dnmt3b antibody [EPR3523] (ab79822)

  •  
  • Product image

    Anti-Niemann Pick C2 antibody (ab186829)

  •  
  • Product image

    Anti-FAM96B antibody (ab254857)

  •  
  • Product image

    Anti-Crk p38 antibody (ab151466)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.