Recombinant human APRIL/TNFSF13 protein (Active) (ab245783)
Key features and details
- Expression system: Insect cells
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE, HPLC
-
Product name
Recombinant human APRIL/TNFSF13 protein (Active)
See all APRIL/TNFSF13 proteins and peptides -
Biological activity
Determined by its ability to induce NF-κB activation in HEK293-NF-κB reporter cells transfected with BCMA receptor.
-
Expression system
Insect cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
AVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYG VRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHP DRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL -
Predicted molecular weight
16 kDa -
Amino acids
105 to 250 -
Additional sequence information
Full-length mature chain lacking the pro-peptide.
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituents: 0.16% Sodium phosphate, 2.9% Sodium chloride, 5% Trehalose
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute in water to 0.1 - 0.5 mg/ml.
