Recombinant Human alpha 2 Macroglobulin protein (ab157817)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: WB, ELISA
-
Product name
Recombinant Human alpha 2 Macroglobulin protein
See all alpha 2 Macroglobulin proteins and peptides -
Expression system
Wheat germ -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
DCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCP QLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTET -
Amino acids
641 to 730 -
Tags
GST tag N-Terminus
-
Preparation and Storage
-
Alternative names
- A2m
- A2MG_HUMAN
- Alpha 2 M
see all -
Function
Is able to inhibit all four classes of proteinases by a unique 'trapping' mechanism. This protein has a peptide stretch, called the 'bait region' which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein which traps the proteinase. The entrapped enzyme remains active against low molecular weight substrates (activity against high molecular weight substrates is greatly reduced). Following cleavage in the bait region a thioester bond is hydrolyzed and mediates the covalent binding of the protein to the proteinase. -
Tissue specificity
Secreted in plasma. -
Sequence similarities
Belongs to the protease inhibitor I39 (alpha-2-macroglobulin) family. -
Developmental stage
Contrary to the rat protein, which is an acute phase protein, this protein is always present at high levels in circulation. -
Cellular localization
Secreted. - Information by UniProt
Images
-
SDS-PAGE - Recombinant Human alpha 2 Macroglobulin protein (ab157817)ab157817 on a 12.5% SDS-PAGE stained with Coomassie Blue.
