Recombinant Human Alpha 1 microglobulin protein (ab157883)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: WB, ELISA
-
Product name
Recombinant Human Alpha 1 microglobulin protein
See all Alpha 1 microglobulin proteins and peptides -
Expression system
Wheat germ -
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
AGPVPTPPDNIQVQGNFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTL VLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITM ESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVV AQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVRRAVLPQEEEGSGGG QLVTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNG NNFVTEKECLQTCRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFPYG GCQGNGNKFYSEKECREYCGVPGDGDEELLRFSN -
Amino acids
19 to 352 -
Tags
GST tag N-Terminus
-
Preparation and Storage
-
Alternative names
- A1M
- Alpha 1 microglobulin/bikunin precursor
- Alpha 1 microglycoprotein
see all -
Function
Inter-alpha-trypsin inhibitor inhibits trypsin, plasmin, and lysosomal granulocytic elastase. Inhibits calcium oxalate crystallization.
Trypstatin is a trypsin inhibitor. -
Tissue specificity
Expressed by the liver and secreted in plasma. Alpha-1-microglobulin occurs in many physiological fluids including plasma, urine, and cerebrospinal fluid. Inter-alpha-trypsin inhibitor is present in plasma and urine. -
Sequence similarities
In the N-terminal section; belongs to the calycin superfamily. Lipocalin family.
Contains 2 BPTI/Kunitz inhibitor domains. -
Post-translational
modificationsThe precursor is proteolytically processed into separately functioning proteins.
3-hydroxykynurenine, an oxidized tryptophan metabolite that is common in biological fluids, reacts with Cys-53, Lys-111, Lys-137, and Lys-149 to form heterogeneous polycyclic chromophores including hydroxanthommatin. The reaction by alpha-1-microglobulin is autocatalytic; the human protein forms chromophore even when expressed in insect and bacterial cells. The chromophore can react with accessible cysteines forming non-reducible thioether cross-links with other molecules of alpha-1-microglobulin or with other proteins such as Ig alpha-1 chain C region 'Cys-352'.
Heavy chains are interlinked with bikunin via a chondroitin 4-sulfate bridge to the their C-terminal aspartate.
Addition of glycosaminoglycan chondroitin sulfate, allows cross-linking between the different components. -
Cellular localization
Secreted. - Information by UniProt