Recombinant Horse Interferon gamma protein (ab208975)
Key features and details
- Expression system: Yeast
- Purity: > 95% SDS-PAGE
- Suitable for: SDS-PAGE
-
Product name
Recombinant Horse Interferon gamma protein
See all Interferon gamma proteins and peptides -
Purity
> 95 % SDS-PAGE.
ab208975 was purified by Ion-exchange chromatography. -
Expression system
Yeast -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Equus -
Sequence
YYCQAAFFKEIENLKEYFNASNPDVGDGGPLFLDILKNWKEDSDKKIIQS QIVSFYFKLFENLKDNQVIQKSMDTIKEDLFAKFFNSSTSKLEDFQKLIQ IPVNDLKVQRKAISELIKVMNDLSPKANLRKRKRSQNPFRGRRALQ -
Predicted molecular weight
17 kDa -
Amino acids
21 to 166 -
Additional sequence information
This product is the mature full length protein from aa 21 to 166. The signal peptide is not included.
-
Preparation and Storage
-
Alternative names
- IF 1
- IFG
- IFI
see all -
Function
Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons. -
Tissue specificity
Released primarily from activated T lymphocytes. -
Involvement in disease
In Caucasians, genetic variation in IFNG is associated with the risk of aplastic anemia (AA) [MIM:609135]. AA is a rare disease in which the reduction of the circulating blood cells results from damage to the stem cell pool in bone marrow. In most patients, the stem cell lesion is caused by an autoimmune attack. T-lymphocytes, activated by an endogenous or exogenous, and most often unknown antigenic stimulus, secrete cytokines, including IFN-gamma, which would in turn be able to suppress hematopoiesis. -
Sequence similarities
Belongs to the type II (or gamma) interferon family. -
Post-translational
modificationsProteolytic processing produces C-terminal heterogeneity, with proteins ending alternatively at Gly-150, Met-157 or Gly-161. -
Cellular localization
Secreted. - Information by UniProt