Recombinant Hepatitis B virus Protein X (His tag) (ab236464)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Endotoxin level:
- Tags: His tag N-Terminus
-
Product name
Recombinant Hepatitis B virus Protein X (His tag)
See all Protein X proteins and peptides -
Purity
> 90 % SDS-PAGE.
Purity as determined by densitometric image analysis: >90%. Protein quantified by BCA. -
Endotoxin level
Expression system
Escherichia coliAccession
Protein length
Protein fragmentAnimal free
NoNature
Recombinant-
Species
Hepatitis B virus -
Sequence
MRGSHHHHHHGSAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPS PSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQVL PKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRH KLVCSPAPCNFFTSA -
Predicted molecular weight
18 kDa including tags -
Amino acids
2 to 154 -
Tags
His tag N-Terminus -
Additional sequence information
Hepatitis B virus genotype C subtype adr (strain Japan/adr4/1983) (HBV-C).
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab236464 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Mass spectrometry
LC-MS/MS -
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at Room Temperature. Store at -80°C. Avoid freeze / thaw cycle.
Constituent: 5% Trehalose
50 mM Acetate buffer. (0.4 µm filtered). -
ReconstitutionAdd 0.1 M acetate buffer pH 4.0 to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for one week.
General Info
-
Alternative names
- HBx
- Peptide X
- Protein X
see all -
Relevance
Protein X from Hepatitis B virus genotype C subtype adr (strain Japan/adr4/1983) (HBV-C). Multifunctional protein that may modulate protein degradation pathways, apoptosis, transcription, signal transduction, cell cycle progress, and genetic stability by directly or indirectly interacting with hosts factors. Does not seem to be essential for HBV infection. May be directly involved in development of cirrhosis and liver cancer (hepatocellular carcinoma). Most of cytosolic activities involve modulation of cytosolic calcium. The effect on apoptosis is controversial depending on the cell types in which the studies have been conducted. By binding to human DDB1, may affect cell viability and stimulate genome replication. May induce apoptosis by localizing in mitochondria and causing loss of mitochondrial membrane potential. May also modulate apoptosis by binding human CFLAR, a key regulator of the death-inducing signaling complex (DISC). Moderately stimulates transcription of many different viral and cellular transcription elements. Promoters and enhancers stimulated by HBx contain DNA binding sites for NF-kappa-B, AP-1, AP-2, c-EBP, ATF/CREB, or the calcium-activated factor NF-AT. May bind bZIP transcription factors like CREB1 -
Cellular localization
Host cytoplasm. Host nucleus. Host mitochondrion
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab236464 has not yet been referenced specifically in any publications.
Preparation and Storage
-
Stability and Storage
Shipped at Room Temperature. Store at -80°C. Avoid freeze / thaw cycle.
Constituent: 5% Trehalose
50 mM Acetate buffer. (0.4 µm filtered). -
ReconstitutionAdd 0.1 M acetate buffer pH 4.0 to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for one week.