Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category

Recombinant Hepatitis B virus Protein X (His tag) (ab236464)

Key features and details

  • Expression system: Escherichia coli
  • Purity: > 90% SDS-PAGE
  • Endotoxin level:
  • Tags: His tag N-Terminus

You may also be interested in

Product image
Anti-XPA antibody (ab180618)
Product image
Anti-OSBPL9 antibody (ab127746)
Product image
Monkey IL-8 ELISA Kit (ab242232)
Product image
Anti-G-CSF antibody [SPM468] (ab233855)

Description

  • Product name

    Recombinant Hepatitis B virus Protein X (His tag)
    See all Protein X proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    Purity as determined by densitometric image analysis: >90%. Protein quantified by BCA.
  • Endotoxin level

  • Expression system

    Escherichia coli
  • Accession

    P12936
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Hepatitis B virus
    • Sequence

      MRGSHHHHHHGSAARVCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLPS PSSSAVPADHGAHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQVL PKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRH KLVCSPAPCNFFTSA
    • Predicted molecular weight

      18 kDa including tags
    • Amino acids

      2 to 154
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Hepatitis B virus genotype C subtype adr (strain Japan/adr4/1983) (HBV-C).
  • Associated products

    • Related Products

      • Anti-6X His tag® antibody [HIS.H8] (ab18184)
      • Anti-6X His tag® antibody [4D11] (ab5000)
      • Anti-6X His tag® antibody (ab9108)

    Specifications

    Our Abpromise guarantee covers the use of ab236464 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Mass spectrometry

      LC-MS/MS
    • Form

      Lyophilized
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at Room Temperature. Store at -80°C. Avoid freeze / thaw cycle.

      Constituent: 5% Trehalose

      50 mM Acetate buffer. (0.4 µm filtered).

    • Reconstitution
      Add 0.1 M acetate buffer pH 4.0 to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for one week.

    General Info

    • Alternative names

      • HBx
      • Peptide X
      • Protein X
      • pX
      • X
      see all
    • Relevance

      Protein X from Hepatitis B virus genotype C subtype adr (strain Japan/adr4/1983) (HBV-C). Multifunctional protein that may modulate protein degradation pathways, apoptosis, transcription, signal transduction, cell cycle progress, and genetic stability by directly or indirectly interacting with hosts factors. Does not seem to be essential for HBV infection. May be directly involved in development of cirrhosis and liver cancer (hepatocellular carcinoma). Most of cytosolic activities involve modulation of cytosolic calcium. The effect on apoptosis is controversial depending on the cell types in which the studies have been conducted. By binding to human DDB1, may affect cell viability and stimulate genome replication. May induce apoptosis by localizing in mitochondria and causing loss of mitochondrial membrane potential. May also modulate apoptosis by binding human CFLAR, a key regulator of the death-inducing signaling complex (DISC). Moderately stimulates transcription of many different viral and cellular transcription elements. Promoters and enhancers stimulated by HBx contain DNA binding sites for NF-kappa-B, AP-1, AP-2, c-EBP, ATF/CREB, or the calcium-activated factor NF-AT. May bind bZIP transcription factors like CREB1
    • Cellular localization

      Host cytoplasm. Host nucleus. Host mitochondrion

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab236464? Please let us know so that we can cite the reference in this datasheet.

    ab236464 has not yet been referenced specifically in any publications.

    Preparation and Storage

    • Stability and Storage

      Shipped at Room Temperature. Store at -80°C. Avoid freeze / thaw cycle.

      Constituent: 5% Trehalose

      50 mM Acetate buffer. (0.4 µm filtered).

    • Reconstitution
      Add 0.1 M acetate buffer pH 4.0 to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for one week.

    Images

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Alternative products to Recombinant Hepatitis B virus Protein X (His tag) (ab236464)

    •  
    • Product image

      Recombinant Hepatitis B virus Protein X (ab203540)

      Applications: ELISA, SDS-PAGE, WB

    Clear all

    Recently viewed products

    •  
    • Product image

      Anti-MUC2 antibody [SPM513], prediluted (ab52130)

    •  
    • Product image

      Anti-RSRP1 antibody (ab228889)

    •  
    • Product image

      Recombinant Antifungal protein (His tag) (ab226283)

    •  
    • Product image

      Recombinant Human Hsp22/HSPB8 protein (Tagged) (ab268608)

    Get resources and offers direct to your inbox Sign up
    © 2021 Astana Biomed Group LLP. All rights reserved.