Recombinant Cynomolgus monkey Prealbumin protein (His tag) (ab239566)
Key features and details
- Expression system: Mammalian
- Purity: > 90% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE, MS
-
Product name
Recombinant Cynomolgus monkey Prealbumin protein (His tag)
See all Prealbumin proteins and peptides -
Purity
> 90 % SDS-PAGE. -
Expression system
Mammalian -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Cynomolgus monkey -
Sequence
GPTGVDESKCPLMVKVLDAVRGSPAVNVAVNVFKKAADETWAPFASGKTS ESGELHGLTTEEEFVEGIYKVEIDTKSYWKSLGISPFHEHAEVVFTANDS GPRHYTIAALLSPYSYSTTAVVTNPKE -
Predicted molecular weight
18 kDa including tags -
Amino acids
21 to 147 -
Tags
His tag N-Terminus -
Additional sequence information
N-terminal 6xHis-tagged. Full length mature chain without signal peptide.
-
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituents: Tris buffer, 50% Glycerol (glycerin, glycerine)
Images
-
SDS-PAGE - Recombinant Cynomolgus monkey Prealbumin protein (His tag) (ab239566)
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab239566.
-
Mass Spectrometry - Recombinant Cynomolgus monkey Prealbumin protein (His tag) (ab239566)Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result of ab239566 could indicate that this peptide derived from Mammalian Cell-expressed Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) TTR.
-
Mass Spectrometry - Recombinant Cynomolgus monkey Prealbumin protein (His tag) (ab239566)Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result of ab239566 could indicate that this peptide derived from Mammalian Cell-expressed Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) TTR.
