omega-Agatoxin TK, CaV2.1 P/Q-type calcium channel blocker (ab141780)
Key features and details
- Potent, selective CaV2.1 P/Q-type calcium channel blocker
- CAS Number: 158484-42-5
- Purity: > 99%
- Soluble in water
- Form / State: Solid
- Source: Synthetic
Overview
-
Product name
omega-Agatoxin TK, CaV2.1 P/Q-type calcium channel blocker -
Description
Potent, selective CaV2.1 P/Q-type calcium channel blocker -
Biological description
Potent, selective CaV2.1 P/Q-type calcium channel blocker (Kd = 3 nM, P-type). Inhibits the high K+ depolarisation-induced rise in internal Ca2+ in nerve endings (IC50 = 60 nM) . -
Purity
> 99% -
CAS Number
158484-42-5 -
Chemical structure
Properties
-
Molecular weight
5273.00 -
Molecular formula
C215H337N65O70S10 -
Sequence
EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA (Modifications: Ser-46 = D-Ser; Disulfide bonds: 4-20, 12-25, 19-36, 27-34) -
Storage instructions
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Solubility overview
Soluble in water -
Handling
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Synthetic
-
Research areas