GLP 1 (1-37) (human, rat), Glucagon-like peptide analog (ab142024)
Key features and details
- Glucagon-like peptide analog
- CAS Number: 87805-34-3
- Purity: > 95%
- Soluble in water
- Form / State: Solid
- Source: Synthetic
Overview
-
Product name
GLP 1 (1-37) (human, rat), Glucagon-like peptide analog -
Description
Glucagon-like peptide analog -
Biological description
Glucagon-like peptide (GLP) 1 analog which is produced through posttranslational processing of proglucagon. Converts intestinal epithelial cells into insulin-producing cells.
-
Purity
> 95% -
CAS Number
87805-34-3 -
Chemical structure
Properties
-
Molecular weight
4169.52 -
Molecular formula
C186H275N51O59 -
Sequence
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG -
PubChem identifier
16131070 -
Storage instructions
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months. -
Solubility overview
Soluble in water -
Handling
This product is supplied in one (or more) pack size which is freeze dried. Therefore the contents may not be readily visible, as they can coat the bottom or walls of the vial. Please see our FAQs and information page for more details on handling.
Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.
Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.
-
Source
Synthetic
-
Research areas