FITC Anti-TCR V alpha 12.1 antibody [6D6.6] (ab171107)
Key features and details
- FITC Mouse monoclonal [6D6.6] to TCR V alpha 12.1
- Suitable for: Flow Cyt
- Reacts with: Human
- Conjugation: FITC. Ex: 493nm, Em: 528nm
- Isotype: IgG1
Overview
-
Product name
FITC Anti-TCR V alpha 12.1 antibody [6D6.6] -
Description
FITC Mouse monoclonal [6D6.6] to TCR V alpha 12.1 -
Host species
Mouse -
Conjugation
FITC. Ex: 493nm, Em: 528nm -
Tested Applications & Species
See all applications and species dataApplication Species Flow Cyt MouseWB Mouse -
Immunogen
Full length protein corresponding to Human TCR V alpha 12.1 aa 1-142.
Sequence:PNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTV LDMRSMDFKS NSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDV KLVEKSFETDTNLNFQNLSVIGFRILLLKVAGFNLLMTLRLWSS
Database link: P01848
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C. Store In the Dark. -
Storage buffer
Preservative: 0.1% Sodium azide
Constituents: 99% PBS, 0.5% BSA -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Monoclonal -
Clone number
6D6.6 -
Isotype
IgG1 -
Research areas
Images
-
Flow cytometry analysis of TCR V alpha 12.1 showing positive staining in the membrane of peripheral blood mononuclear cells compared to an isotype control (blue). Human blood was collected and combined with a hydrophilic polysaccharide then centrifuged. Samples were transferred to a conical tube and washed with PBS. 50 ul of cell solution was added to each tube at a dilution of 2x10^7 cells/ml and 50 ul of isotype control and ab171107 at 1:20 added. Cells were incubated for 30 min at 4oC and washed with a cell buffer and incubated with a DyLight 488-conjugated goat anti-mouse IgG (H+L) secondary for 30 min at 4oC in the dark. FACS analysis was performed using 400 ul of cell buffer.
-
Flow cytometry analysis of TCR V alpha 12.1 showing positive staining in the membrane of peripheral blood mononuclear cells compared to an isotype control (blue). Human blood was collected and combined with a hydrophilic polysaccharide then centrifuged. Samples were transferred to a conical tube and washed with PBS. 50 ul of cell solution was added to each tube at a dilution of 2x10^7 cells/ml and 50 ul of isotype control and ab171107 at 1:20 addded. Cells were incubated for 30 min at 4oC and washed with a cell buffer and incubated with a DyLight 488-conjugated goat anti-mouse IgG (H+L) secondary for 30 min at 4oC in the dark. FACS analysis was performed using 400 ul of cell buffer.