Anti-ZIP Kinase antibody (ab151956)
Key features and details
- Rabbit polyclonal to ZIP Kinase
- Suitable for: WB, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-ZIP Kinase antibody
See all ZIP Kinase primary antibodies -
Description
Rabbit polyclonal to ZIP Kinase -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow, Xenopus laevis, Xenopus tropicalis
-
Immunogen
Recombinant fragment corresponding to Human ZIP Kinase aa 1-172.
Sequence:MSTFRQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLS SSRRGVSREEIEREVNILREIRHPNIITLHDIFENKTDVVLILELVSGGE LFDFLAEKESLTEDEATQFLKQILDGVHYLHSKRIAHFDLKPENIMLLDK NVPNPRIKLIDFGIAHKIEAGN
Database link: O43293 -
Positive control
- A549 whole cell lysate, HeLa cells
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.00
Preservative: 0.01% Thimerosal (merthiolate)
Constituents: 1.21% Tris, 0.75% Glycine, 10% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Immunofluorescent analysis of 4% paraformaldehyde-fixed (RT for 15 min) HeLa cells labeling ZIP Kinase with ab151956 at 1/500 (green) showing nuclear staining.
Red: alpha Tubulin, a cytoskeleton marker.
-
Anti-ZIP Kinase antibody (ab151956) at 1/500 dilution + A549 whole cell lysate at 30 µg
Predicted band size: 53 kDa
10% SDS PAGE

