Anti-ZEB1 antibody [OTI3G6] - N-terminal (ab180905)
Key features and details
- Mouse monoclonal [OTI3G6] to ZEB1 - N-terminal
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG2a
Overview
-
Product name
Anti-ZEB1 antibody [OTI3G6] - N-terminal
See all ZEB1 primary antibodies -
Description
Mouse monoclonal [OTI3G6] to ZEB1 - N-terminal -
Host species
Mouse -
Specificity
Does not cross react with ZEB2. -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Chicken -
Immunogen
Recombinant fragment corresponding to Human ZEB1 aa 1-350 (N terminal). Produced in E.coli (NP_110378).
Sequence:MADGPRCKRRKQANPRRNNVTNYNTVVETNSDSDDEDKLHIVEEESVTDA ADCEGVPEDDLPTDQTVLPGRSSEREGNAKNCWEDDRKEGQEILGPEAQA DEAGCTVKDDECESDAENEQNHDPNVEEFLQQQDTAVIFPEAPEEDQRQG TPEASGHDENGTPDAFSQLLTCPYCDRGYKRFTSLKEHIKYRHEKNEDNF SCSLCSYTFAYRTQLERHMTSHKSGRDQRHVTQSGCNRKFKCTECGKAFK YKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLIPVNG RPRTGLKTSQCSSPSLSASPGSPTRPQIRQKIENKPLQEQLSVNQIKTEP
Database link: NP_110378 -
Positive control
- WB: HEK293T cell lysate, transfected with pCMV6-ENTRY ZEB1 cDNA. IHC-P: Human lung carcinoma, breast adenocarcinoma, kidney carcinoma, endometrium adenocarcinoma, prostate and lymph node tissues.
-
General notes
Dilute in PBS (pH7.3) if necessary.
The clone number has been updated from 3G6 to OTI3G6, both clone numbers name the same clone.
This product was changed from ascites to tissue culture supernatant on 6th September 2018. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 50% Glycerol, 1% BSA, 48% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Purification notes
Purified from TCS -
Clonality
Monoclonal -
Clone number
OTI3G6 -
Isotype
IgG2a -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ZEB1 antibody [OTI3G6] - N-terminal (ab180905)
Immunohistochemical analysis of paraffin-embedded Human lymph node tissue labeling ZEB1 with ab180905 at 1/150 dilution.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ZEB1 antibody [OTI3G6] - N-terminal (ab180905)
Immunohistochemical analysis of paraffin-embedded Human prostate tissue labeling ZEB1 with ab180905 at 1/150 dilution.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ZEB1 antibody [OTI3G6] - N-terminal (ab180905)
Immunohistochemical analysis of paraffin-embedded Human endometrium adenocarcinoma tissue labeling ZEB1 with ab180905 at 1/150 dilution.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ZEB1 antibody [OTI3G6] - N-terminal (ab180905)
Immunohistochemical analysis of paraffin-embedded Human lung carcinoma tissue labeling ZEB1 with ab180905 at 1/150 dilution.