Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Epigenetics and Nuclear Signaling Transcription Domain Families Zinc Finger

Anti-ZEB1 antibody [OTI3G6] - N-terminal (ab180905)

Price and availability

291 484 ₸

Availability

Order now and get it on Wednesday February 24, 2021

Anti-ZEB1 antibody [OTI3G6] - N-terminal (ab180905)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Mouse monoclonal [OTI3G6] to ZEB1 - N-terminal
  • Suitable for: IHC-P
  • Reacts with: Human
  • Isotype: IgG2a

You may also be interested in

Product image
Alexa Fluor® 488 Anti-Zic2 antibody [EPR7790] (ab225197)
Product image
Anti-ZNF124 antibody (ab168627)
Product image
Anti-Estrogen Receptor beta antibody (ab196787)
Product image
Recombinant Human Gli2 protein (His tag) (ab267902)

Overview

  • Product name

    Anti-ZEB1 antibody [OTI3G6] - N-terminal
    See all ZEB1 primary antibodies
  • Description

    Mouse monoclonal [OTI3G6] to ZEB1 - N-terminal
  • Host species

    Mouse
  • Specificity

    Does not cross react with ZEB2.
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken
  • Immunogen

    Recombinant fragment corresponding to Human ZEB1 aa 1-350 (N terminal). Produced in E.coli (NP_110378).
    Sequence:

    MADGPRCKRRKQANPRRNNVTNYNTVVETNSDSDDEDKLHIVEEESVTDA ADCEGVPEDDLPTDQTVLPGRSSEREGNAKNCWEDDRKEGQEILGPEAQA DEAGCTVKDDECESDAENEQNHDPNVEEFLQQQDTAVIFPEAPEEDQRQG TPEASGHDENGTPDAFSQLLTCPYCDRGYKRFTSLKEHIKYRHEKNEDNF SCSLCSYTFAYRTQLERHMTSHKSGRDQRHVTQSGCNRKFKCTECGKAFK YKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLIPVNG RPRTGLKTSQCSSPSLSASPGSPTRPQIRQKIENKPLQEQLSVNQIKTEP


    Database link: NP_110378
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • WB: HEK293T cell lysate, transfected with pCMV6-ENTRY ZEB1 cDNA. IHC-P: Human lung carcinoma, breast adenocarcinoma, kidney carcinoma, endometrium adenocarcinoma, prostate and lymph node tissues.
  • General notes

    Dilute in PBS (pH7.3) if necessary.

    The clone number has been updated from 3G6 to OTI3G6, both clone numbers name the same clone.

    This product was changed from ascites to tissue culture supernatant on 6th September 2018. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.

     

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, 1% BSA, 48% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Purified from TCS
  • Clonality

    Monoclonal
  • Clone number

    OTI3G6
  • Isotype

    IgG2a
  • Research areas

    • Epigenetics and Nuclear Signaling
    • Transcription
    • Domain Families
    • Zinc Finger
    • Cancer
    • Signal transduction
    • Other

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ZEB1 antibody [OTI3G6] - N-terminal (ab180905)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ZEB1 antibody [OTI3G6] - N-terminal (ab180905)

    Immunohistochemical analysis of paraffin-embedded Human lymph node tissue labeling ZEB1 with ab180905 at 1/150 dilution.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ZEB1 antibody [OTI3G6] - N-terminal (ab180905)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ZEB1 antibody [OTI3G6] - N-terminal (ab180905)

    Immunohistochemical analysis of paraffin-embedded Human prostate tissue labeling ZEB1 with ab180905 at 1/150 dilution.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ZEB1 antibody [OTI3G6] - N-terminal (ab180905)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ZEB1 antibody [OTI3G6] - N-terminal (ab180905)

    Immunohistochemical analysis of paraffin-embedded Human endometrium adenocarcinoma tissue labeling ZEB1 with ab180905 at 1/150 dilution.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ZEB1 antibody [OTI3G6] - N-terminal (ab180905)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ZEB1 antibody [OTI3G6] - N-terminal (ab180905)

    Immunohistochemical analysis of paraffin-embedded Human lung carcinoma tissue labeling ZEB1 with ab180905 at 1/150 dilution.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-ZEB1 antibody [OTI3G6] - N-terminal (ab180905)

  •  
  • Product image

    Anti-ZEB1 antibody [2A8A6] (ab181451)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

  •  
  • Product image

    Alexa Fluor® 488 Anti-ZEB1 antibody [EPR17375] (ab215964)

    Applications: ICC/IF

  •  
  • Product image

    Anti-ZEB1 antibody (ab81972)

    Applications: WB

  •  
  • Product image

    Anti-ZEB1 antibody (ab245282)

    Applications: IP, WB

  •  
  • Product image

    Anti-ZEB1 antibody [EPR17375] (ab203829)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-ZEB1 antibody [EPR17375] - BSA and Azide free (ab228986)

    Applications: Flow Cyt, ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-ZEB1 antibody (ab155249)

    Applications: ChIP, ICC/IF, IP, WB

  •  
  • Product image

    Anti-ZEB1 antibody (ab245283)

    Applications: IHC-P, IP, WB

  •  
  • Product image

    Anti-ZEB1 antibody (ab87280)

    Applications: IHC-P

Clear all

Recently viewed products

  •  
  • Product image

    Anti-Ferritin Light Chain antibody [CPT-R10-58-11] (ab243096)

  •  
  • Product image

    Human FLOT1 (Flotillin 1) knockout HEK-293T cell line (ab267276)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.