Anti-YIF1A antibody (ab121455)
Key features and details
- Rabbit polyclonal to YIF1A
- Suitable for: IHC-P, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-YIF1A antibody -
Description
Rabbit polyclonal to YIF1A -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species IHC-P HumanWB Human -
Immunogen
antigen sequence corresponding to amino acids 240-269 (
ALMYFIVRSLRTAALGPDSMGGPVPRQRLQ
) of Human YIF1A. -
Positive control
- WB: RT-4 and U-251 MG cell lysates. IHC-P: Human prostate, colon, skeletal muscle and pancreas tissues.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-YIF1A antibody (ab121455) at 1/250 dilution
Lane 1 : Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2 : RT-4 cell lysate
Lane 3 : U-251 MG cell lysate
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-YIF1A antibody (ab121455)
Immunohistochemical analysis of human prostate tissue lableing YIF1A with ab121455 at 1/200 dilution.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-YIF1A antibody (ab121455)
Immunohistochemical analysis of human colon tissue lableing YIF1A with ab121455 at 1/200 dilution.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-YIF1A antibody (ab121455)
Immunohistochemical analysis of human skeletal muscle tissue lableing YIF1A with ab121455 at 1/200 dilution.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-YIF1A antibody (ab121455)
Immunohistochemical analysis of human pancreas tissue lableing YIF1A with ab121455 at 1/200 dilution.