Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Epigenetics and Nuclear Signaling Chromatin Modifying Enzymes Methylation

Anti-WDR5 antibody (ab176588)

Anti-WDR5 antibody (ab176588)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to WDR5
  • Suitable for: IHC-P
  • Reacts with: Mouse, Human
  • Isotype: IgG

You may also be interested in

Product image
Recombinant human RBBP4 + EED + SUZ12 + AEBP2 + EZH2 (mutated P132S) protein (Active) (ab271504)
Product image
Anti-KMT5A / SETD8 / Pr-SET7 antibody (ab230683)
Product image
Anti-SET7 antibody - BSA and Azide free (Capture) (ab281524)
Product image
Anti-RTF1 antibody (ab84564)

Overview

  • Product name

    Anti-WDR5 antibody
    See all WDR5 primary antibodies
  • Description

    Rabbit polyclonal to WDR5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Horse, Chicken, Cow, Dog, Pig, Xenopus laevis, Drosophila melanogaster, Zebrafish, Orangutan, Xenopus tropicalis
  • Immunogen

    Synthetic peptide within Human WDR5 aa 50-100. The exact sequence is proprietary. (NP_060058.1).
    Sequence:

    SVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDS N


    Database link: P61964
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 6.8
    Preservative: 0.09% Sodium azide
    Constituents: 99% Tris buffered saline, 0.1% BSA
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab176588 was affinity purified using an epitope specific to WDR5 immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Epigenetics and Nuclear Signaling
    • Chromatin Modifying Enzymes
    • Methylation
    • Epigenetics and Nuclear Signaling
    • Chromatin Binding Proteins
    • Methyl Lysine
    • Epigenetics and Nuclear Signaling
    • Chromatin Remodeling
    • Trithorax

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-WDR5 antibody (ab176588)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-WDR5 antibody (ab176588)

    Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse renal cell carcinoma tissue labeling WDR5 with ab176588 at 1/250 dilution. Detection: DAB staining.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-WDR5 antibody (ab176588)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-WDR5 antibody (ab176588)

    Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human ovarian carcinoma tissue labeling WDR5  with ab176588 at 1/250 dilution. Detection: DAB staining.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-WDR5 antibody (ab176588)

  •  
  • Product image

    Anti-WDR5 antibody [EPR11350] - C-terminal (ab178410)

    Applications: Flow Cyt, IHC-P, WB

  •  
  • Product image

    Anti-WDR5 antibody - N-terminal (ab189932)

    Applications: ICC, ICC/IF, IHC-P, WB

  •  
  • Product image

    Anti-WDR5 antibody (ab245479)

    Applications: IHC-P, IP

  •  
  • Product image

    Anti-WDR5 antibody (ab187178)

    Applications: IHC-P, WB

  •  
  • Product image

    Anti-WDR5 antibody [2C2] (ab56919)

    Applications: Flow Cyt, ICC/IF, WB

  •  
  • Product image

    Anti-WDR5 antibody (ab22512)

    Applications: ICC/IF, WB

  •  
  • Product image

    Anti-WDR5 antibody [EPR11349(B)] (ab156012)

    Applications: WB

Clear all

Recently viewed products

  •  
  • Product image

    Total OXPHOS Rodent WB Antibody Cocktail (ab110413)

  •  
  • Product image

    Anti-NDEL1 antibody [EPR5068] (ab124895)

  •  
  • Product image

    Anti-CNDP2/CN2 antibody (ab204351)

  •  
  • Product image

    Anti-GAD1 antibody [GAD1/2563] (ab237999)

  •  
  • Product image

    Anti-Cytokeratin 8 antibody [C43] (ab230653)

  •  
  • Product image

    Anti-Tspan-13 antibody (ab133366)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.