Anti-UBA5 antibody (ab177507)
Key features and details
- Rabbit polyclonal to UBA5
- Suitable for: WB, IP
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-UBA5 antibody
See all UBA5 primary antibodies -
Description
Rabbit polyclonal to UBA5 -
Host species
Rabbit -
Tested Applications & Species
See all applications and species dataApplication Species IP HumanWB Human
-
Immunogen
Synthetic peptide within Human UBA5 aa 325-375. The exact sequence is proprietary. (NP_079094.1)
Sequence:QEVIQEEEEIIHEDNEWGIELVSEVSEEELKNFSGPVPDLPEGITV AYTIP
Database link: Q9GZZ9 -
Positive control
- Jurkat, 293T and HeLa whole cell lysates.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7 - 8 -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Western blot - Anti-UBA5 antibody (ab177507)All lanes : Anti-UBA5 antibody (ab177507) at 0.4 µg/ml
Lane 1 : Jurkat whole cell lysate
Lane 2 : 293T whole cell lysate
Lane 3 : HeLa whole cell lysate
Lysates/proteins at 50 µg per lane.
Developed using the ECL technique.
Predicted band size: 45 kDa
Exposure time: 30 seconds
-
Immunoprecipitation - Anti-UBA5 antibody (ab177507)Detection of UBA5 in Immunoprecipitates of Jurkat whole cell lysates (1 mg for IP, 20% of IP loaded) using ab177507 at 6 µg/mg lysate for IP (Lane 1). For WB detection ab177507 was used at 1 µg/ml. Lane 2 represents control IgG IP. Detection: Chemiluminescence with an exposure time of 10 seconds.
