Anti-TRAM1/TRAM antibody (ab96106)
Key features and details
- Rabbit polyclonal to TRAM1/TRAM
- Suitable for: IHC-P, ICC/IF, WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-TRAM1/TRAM antibody
See all TRAM1/TRAM primary antibodies -
Description
Rabbit polyclonal to TRAM1/TRAM -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IF, WBmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Synthetic peptide within Human TRAM1 aa 310-374. The exact sequence is proprietary.
Sequence:FMMWKFINFQLRRWREHSAFQAPAVKKKPTVTKGRSSKKGT ENGVNGTLTSNVADSPRNKKEKSS
Database link: NP_055109 -
Positive control
- WB: H1299 whole cell lysate. IHC: mouse intestinal and AGS xenograft tissue. ICC/IF: HeLa cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.00
Preservative: 0.01% Thimerosal (merthiolate)
Constituents: 1.21% Tris, 0.75% Glycine, 10% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
Anti-TRAM1/TRAM antibody (ab96106) at 1/1000 dilution + H1299 cell lysate at 30 µg
Predicted band size: 43 kDa
10% SDS-PAGE -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of mouse intestine staining TRAM1 with ab96106 at 1/500 dilution.
-
Immunocytochemistry/ Immunofluorescence of methanol-fixed HeLa cells staining TRAM1 with ab96106 at 1/500 dilution (green). Costained with Hoechst 33342 (blue).
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of AGS xenograft staining TRAM1 with ab96106 at 1/500 dilution.