Anti-Syndecan-1 antibody [1A3H4] (ab181789)
Key features and details
- Mouse monoclonal [1A3H4] to Syndecan-1
- Suitable for: IHC-P, WB, ICC/IF, Flow Cyt
- Reacts with: Mouse, Human
- Isotype: IgG1
Overview
-
Product name
Anti-Syndecan-1 antibody [1A3H4]
See all Syndecan-1 primary antibodies -
Description
Mouse monoclonal [1A3H4] to Syndecan-1 -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species Flow Cyt HumanICC/IF HumanIHC-P HumanWB Human -
Immunogen
Recombinant fragment corresponding to Human Syndecan-1 aa 28-171 (internal sequence). Expressed in E. Coli.
Sequence:NLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQTPSTWKDTQLLTAIPTS PEPTGLEATA ASTSTLPAGEGPKEGEAVVLPEVEPGLTAREQEATPRP RETTQLPTTHLASTTTATTAQEPATSHPHRDMQPGHHETSTPAGPS
Database link: P18827 -
Positive control
- Human ovarian and rectum cancer tissues; HepG2 cells; MCF7, HeLa, HepG2, T47D, SW620, Jurkat and mouse NIH 3T3 cell lysates; Human Syndecan-1 recombinant protein (amino acids 28-171); HEK293 cell lysate transfected with Syndecan-1 (amino acids 28-171)-hIgGFc.
-
General notes
This product was changed from ascites to supernatant. Lot no’s high than GR214200-21 are from Tissue Culture Supernatant
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
1A3H4 -
Isotype
IgG1 -
Research areas
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Syndecan-1 antibody [1A3H4] (ab181789)Immunohistochemical analysis of paraffin-embedded Human ovarian cancer tissue labeling Syndecan-1 with ab181789 at 1/200 dilution followed by DAB staining.
-
Anti-Syndecan-1 antibody [1A3H4] (ab181789) at 1/500 dilution + Human Syndecan-1 recombinant protein (amino acids 28-171)
Predicted band size: 32 kDa
-
All lanes : Anti-Syndecan-1 antibody [1A3H4] (ab181789) at 1/500 dilution
Lane 1 : HEK293 cell lysate, non-transfected
Lane 2 : HEK293 cell lysate, transfected with Syndecan-1 (amino acids 28-171)-hIgGFc
Predicted band size: 32 kDa
-
All lanes : Anti-Syndecan-1 antibody [1A3H4] (ab181789) at 1/500 dilution
Lane 1 : MCF7 cell lysate
Lane 2 : HeLa cell lysate
Lane 3 : HepG2 cell lysate
Lane 4 : T47D cell lysate
Lane 5 : SW620 cell lysate
Lane 6 : Jurkat cell lysate
Lane 7 : mouse NIH 3T3 cell lysate
Predicted band size: 32 kDa
-
Immunofluorescent analysis of HepG2 cells labeling Syndecan-1 with ab181789 at 1/200 dilution (green). Blue: DRAQ5 fluorescent DNA dye.
-
Flow cytometric analysis of HepG2 cells labeling Syndecan-1 with ab181789 at 1/200 dilution (green); negative control (red).
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Syndecan-1 antibody [1A3H4] (ab181789)Immunohistochemical analysis of paraffin-embedded Human rectum cancer tissue labeling Syndecan-1 with ab181789 at 1/200 dilution followed by DAB staining.

