Anti-RING1 antibody [8E8A2] (ab181756)
Key features and details
- Mouse monoclonal [8E8A2] to RING1
- Suitable for: WB, ICC/IF
- Reacts with: Human
- Isotype: IgG1
Overview
-
Product name
Anti-RING1 antibody [8E8A2]
See all RING1 primary antibodies -
Description
Mouse monoclonal [8E8A2] to RING1 -
Host species
Mouse -
Tested Applications & Species
See all applications and species dataApplication Species ICC/IF HumanWB Human -
Immunogen
Recombinant fragment corresponding to Human RING1 aa 79-263. Expressed in E. Coli.
Sequence:SGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRL SRLHNQQALSSSIEEGLRMQAMHRAQRVRRPIPGSDQTTTMSGGEGEPGE GEGDGEDVSSDSAPDSAPGPAPKRPRGGGAGGSSVGTGGGGTGGVGGGAG SEDSGDRGGTLGGGTLGPPSPPGAPSPPEPGGEIE
Database link: Q06587 -
Positive control
- RING1 recombinant protein; RING1 (aa 79-263)-hIgGFc transfected HEK293 cell lysate; A431 and HeLa cells.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.
One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.
Learn more here.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS
Contains 0.5% protein stabilizer. -
Concentration information loading... -
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
8E8A2 -
Isotype
IgG1 -
Research areas
Images
-
All lanes : Anti-RING1 antibody [8E8A2] (ab181756) at 1/500 dilution
Lane 1 : HEK293 cell lysate, non-transfected
Lane 2 : HEK293 cell lysate, transfected with RING1 (aa 79-263)-hIgGFc
Predicted band size: 42 kDa
-
Anti-RING1 antibody [8E8A2] (ab181756) at 1/500 dilution + Human RING1 recombinant protein
Predicted band size: 42 kDa
-
Immunofluorescent analysis of HeLa cells labeling RING1 with ab181756 at 1/200 dilution (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
-
Immunofluorescent analysis of A431 cells labeling RING1 with ab181756 at 1/200 dilution (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.

