Call: +7 771 977 66 65, +7 705 421 2277
Sign in or Register
My basket

Astana Biomed Group, an authorized Abcam distributor in Central Asia

Abiomed homepage

  • Categories
    Signal Transduction
    Cancer
    Epigenetics and Nuclear Signaling
    Immunology
    Cell Biology
    Cardiovascular
    Neuroscience
    Tags & Cell Markers
    Kits/ Lysates/ Other
    Developmental Biology
    Microbiology
    Biochemicals
    Secondary antibodies
    Isotype/Loading Controls
    Antibody Arrays
  • About us
  • Partners
  • Contact
    Address

    Saryarka 32, 18, 010000, Astana city, Kazakhstan

    Telephone +7 771 977 66 65, +7 705 421 2277

    Email

    laboratory@ctlab.kz, orders@abiomed.kz

Back to category
Signal Transduction Signaling Pathway G Protein Signaling Small G Proteins Other

Anti-RECQL5 antibody (ab91422)

Price and availability

284 784 ₸

Availability

Order now and get it on Thursday February 25, 2021

Anti-RECQL5 antibody (ab91422)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)
  • ChIP - Anti-Histone H3 antibody - Nuclear Loading Control and ChIP Grade (ab1791)

Key features and details

  • Rabbit polyclonal to RECQL5
  • Suitable for: IHC-P, WB, IP
  • Reacts with: Human
  • Isotype: IgG

You may also be interested in

Product image
Anti-WISP1 antibody [EPR22852-267] - BSA and Azide free (ab263948)
Product image
Anti-PAR1/Thrombin Receptor antibody - BSA and Azide free (Capture) (ab281275)
Product image
Human PAK4 knockout HEK-293T cell line (ab266807)
Product image
Anti-LYPD3 antibody [EPR9107] (ab151709)

Overview

  • Product name

    Anti-RECQL5 antibody
    See all RECQL5 primary antibodies
  • Description

    Rabbit polyclonal to RECQL5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, IPmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Gorilla, Orangutan
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 1 - 50 (MSSHHTTFPFDPERRVRSTLKKVFGFDSFKTPLQESATMAVVKGNKDVF V) of Human RECQL5 (NP_004250.4).

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • HeLa cell lysate
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    pH: 7
    Preservative: 0.09% Sodium azide
    Constituent: Tris citrate/phosphate
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Epigenetics and Nuclear Signaling
    • DNA / RNA
    • DNA Damage & Repair
    • DNA Damage Response
    • Other

Images

  • Western blot - Anti-RECQL5 antibody (ab91422)
    Western blot - Anti-RECQL5 antibody (ab91422)
    All lanes : Anti-RECQL5 antibody (ab91422) at 0.1 µg/ml

    Lane 1 : HeLa cell lysate at 50 µg
    Lane 2 : HeLa cell lysate at 15 µg
    Lane 3 : HeLa cell lysate at 5 µg

    Predicted band size: 109 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RECQL5 antibody (ab91422)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-RECQL5 antibody (ab91422)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human breast carcinoma tissue labelling RECQL5 with ab91422 at 1/1000 (1µg/ml). Detection: DAB.
  • Immunoprecipitation - Anti-RECQL5 antibody (ab91422)
    Immunoprecipitation - Anti-RECQL5 antibody (ab91422)
    SSA1 was immunoprecipitated from 1mg HeLa whole cell lysate using 10µg ab91422.
    20% of the immunoprecipitate was loaded per lane, and probed with ab91422 at 1µg/ml (lane 1) or a control IgG (lane2).
    Detection: chemoluminescence with an exposure time of 10 seconds.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Alternative products to Anti-RECQL5 antibody (ab91422)

  •  
  • Product image

    Anti-RECQL5 antibody (ab224135)

    Applications: ICC/IF, IHC-P, WB

Clear all

Recently viewed products

  •  
  • Product image

    Anti-SPARC antibody (ab203284)

  •  
  • Product image

    Anti-FYCO1 antibody (ab224152)

  •  
  • Recombinant Pig Interferon alpha 1 protein (ab209114)

Get resources and offers direct to your inbox Sign up
© 2021 Astana Biomed Group LLP. All rights reserved.